product: (001x) STUF-M2 (Target Unmasking Fluid Mark2, Basic) @PN=LBU0026A
product: (010x) STUF-M2 (Target Unmasking Fluid Mark2, Basic), Concentrate @PN=LBU0026B
product: (100x) STUF-M2 (Target Unmasking Fluid Mark2, Basic) @PN=LBU0026C
product: (100x) TUFU-M2 (Target Unmasking Fluid Mark2, Universal) @PN=LBU0025C
product: (10x) Antibody- and Conjugate Diluent for ELISA Concentrate @PN=ADI-80070
product: (10x) ELISA Plate Blocking Buffer Concentrate @PN=ADI-80062
product: (1S)-1,5-ANHYDRO-1-C-(3-((5-(4-FLUOROPHENYL)-2-THIENYL)METHYL)-4-METHYLPHENYL)-D-GLUCITOL @PN=MC58356
product: (20x) Tris Buffered Saline w/Tween-20 @PN=LBU0028
product: (DRAAGQPAG)3 (repeat-sequence peptide of the P. vivax circumsporozoite protein, CSP) control/blocking peptide @PN=ADI-DRAA31-P
product: (DRAAGQPAG)3 peptide (repeat-sequence peptide of the P. vivax circumsporozoite protein, CSP) conjugated with BSA @PN=ADI-DRAA31-BSA
product: (DRADGQPAG)3 peptide (repeat-sequence peptide of the P. vivax circumsporozoite protein, CSP), pure @PN=ADI-DRAD31-P
product: (NANP)10 (40-aa NANP repeat-sequence peptide of the P. falciparum circumsporozoite protein, CSP) peptide, pure @PN=ADI-NANP101-P
product: (NANP)5 peptide (25-aa, repeat-sequence peptide of the P. falciparum circumsporozoite protein, CSP) conjugated with BSA @PN=ADI-NANP51-BSA
product: (NANP)5 peptide (repeat-sequence peptide of the P. falciparum circumsporozoite protein, CSP) control/blocking peptide @PN=ADI-NANP51-P
product: (NVDP)4 peptide (minor repeat-sequence peptide of the P. falciparum circumsporozoite protein, CSP) conjugated with BSA @PN=ADI-NVDP41-BSA
product: (NVDP)4 peptide (minor repeat-sequence peptide of the P. falciparum circumsporozoite protein, CSP) control/blocking peptide @PN=ADI-NVDP41-P
product: (PAPPNAAND)3 peptide (repeat-sequence peptide of the P. berghei circumsporozoite protein, CSP), pure @PN=ADI-PAPP311-P
product: (PPPPNAAND)3 peptide (repeat-sequence peptide of the P. berghei circumsporozoite protein, CSP) conjugated with BSA @PN=ADI-PPPP321-BSA
product: (PPPPNAAND)3 peptide (repeat-sequence peptide of the P. berghei circumsporozoite protein, CSP) control/blocking peptide @PN=ADI-PPPP321-P
product: (PPPPNPPND)3 peptide (repeat-sequence peptide of the P. berghei circumsporozoite protein, CSP), pure @PN=ADI-PPPP312-P
product: (Quil-A) Vaccine adjuvant, (EU GMP grade) >95%; @PN=ADI-AV-4040-1
product: -Atriopeptin II, rat, @PN=ADI-SP-101109-1
product: 0.5% Trpsin-EDTA (10X), no Phenol Red @PN=15400-054
product: 1 kb DNA Ladder in TE buffer @PN=31039
product: 1,6-Dipheny-1,3,5-hexatriene @PN=60021
product: 1-hour Beef/Cow meat adulteration ELISA test (for beef or pig meat; 24 tests) @PN=ADI-BMT-24
product: 1-hour Beef/Cow meat adulteration ELISA test (for beef or pig meat; 48 tests) @PN=ADI-BMT-48
product: 1-hour Beef/Cow meat adulteration ELISA test (for beef or pig meat; 96 tests) @PN=ADI-BMT-96
product: 1-hour Dog meat adulteration ELISA test (for beef or pig meat; 24 tests) @PN=ADI-DMT-24
product: 1-hour Dog meat adulteration ELISA test (for beef or pig meat; 48 tests) @PN=ADI-DMT-48
product: 1-hour Dog meat adulteration ELISA test (for beef or pig meat; 48 tests) @PN=ADI-DMT-96
product: 1-hour Horse meat adulteration ELISA test (for beef or pig meat; 24 tests) @PN=ADI-HMT-24
product: 1-hour Horse meat adulteration ELISA test (for beef or pig meat; 48 tests) @PN=ADI-HMT-48
product: 1-hour Horse meat adulteration ELISA test (for beef or pig meat; 96 tests) @PN=ADI-HMT-96
product: 1-hour Pig meat adulteration ELISA test (for beef or pig meat; 24 tests) @PN=ADI-PMT-24
product: 1-hour Pig meat adulteration ELISA test (for beef or pig meat; 48 tests) @PN=ADI-PMT-48
product: 1-hour Pig meat adulteration ELISA test (for beef or pig meat; 96 tests) @PN=ADI-PMT-96
product: 1-hour Rat meat adulteration ELISA test (for beef or pig meat; 24 tests) @PN=ADI-RMT-24
product: 1-hour Rat meat adulteration ELISA test (for beef or pig meat; 48 tests) @PN=ADI-RMT-48
product: 1-hour Rat meat adulteration ELISA test (for beef or pig meat; 48 tests) @PN=ADI-RMT-96
product: 10-ACETYL-3,7-DIHYDROXYPHENOXAZINE @PN=10061
product: 100 bp DNA Ladder in TE buffer @PN=31040
product: 10x ELISA WASH BUFFER @PN=LBU031A
product: 10x ELISA WASH BUFFER @PN=LBU031B
product: 10x ELISA WASH BUFFER @PN=LBU031C
product: 10X Fish Gelatin Blocking Agent @PN=22010
product: 10X PHOSPHATE BUFFERED SALINE @PN=LBU036A
product: 14-3-3 ISOFORM PANEL @PN=LPAN017
product: 19 mer, Antisense primer; DNA aptamer @PN=ADI-DAL-AS-100
product: 2,3-DIAMINONAPHTHALENE @PN=00301
product: 2,6-Dichloropyrazine (>98% pure) @PN=ADI-ABT-450-05
product: 2,7-DICHLORODIHYDROFLUORESCEIN DIACETA @PN=10058
product: 2-(4-AZIDO-2,3,5,6-TETRAFLUOROBENZOYL)A @PN=91032
product: 20 bp random library with flanking sequence; DNA aptamer @PN=ADI-DAL-N-20
product: 21 mer, Sense primer; DNA aptamer @PN=ADI-DAL-PS-100
product: 234 CM [Lys-Tyr-Ile-Cys-Asn-Ser-Ser-Cys-Met; MW: 1048.26] @PN=ADI-SP-88259-5
product: 234 CW [Lys-Tyr-Met-Cys-Asn-Ser-Ser-Cys-Met; MW: 1066.30] @PN=ADI-SP-88260-5
product: 26Rfa, Hypothalamic Peptide, frog [Val-Gly-Thr-Ala-Leu-Gly-Ser-Leu-Ala-Glu-Glu-Leu-Asn-Gly-Tyr-Asn-Arg-Lys-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MW: 2818.21] @PN=ADI-SP-88343-1
product: 26Rfa, Hypothalamic Peptide, human [Thr-Ser-Gly-Pro-Leu-Gly-Asn-Leu-Ala-Glu-Glu-Leu-Asn-Gly-Tyr-Ser-Arg-Lys-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MW: 2832.20] @PN=ADI-SP-67811-1
product: 26Rfa, Hypothalamic Peptide, rat [Ala-Ser-Gly-Pro-Leu-Gly-Thr-Leu-Ala-Glu-Glu-Leu-Ser-Ser-Tyr-Ser-Arg-Arg-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MW: 2820.18] @PN=ADI-SP-88344-1
product: 293 Cell Slide (Human (embryonal) kidney transformed by sheared human adenovirus 5 (Ad 5) DNA) (5 slides/pk) @PN=ADI-HCLS-17010
product: 2A/2B Dengue Protease Substrate [Ac-Arg-Thr-Ser-Lys-Lys-Arg- pNA; MW: 937.08] @PN=ADI-SP-100796-1
product: 2B-(A) [Biotin-Arg-Arg-Ala-Ala-Glu-Glu-Leu-Asp-Ser-Arg-Ala-Gly-Ala-Pro-Gln-Leu-OH; MW: 1983.23] @PN=ADI-SP-55157-1
product: 2B-(pS) [Biotin-Arg-Arg-Ala-Ala-Glu-Glu-Leu-Asp-Ser-Arg-Ala-Gly-pSer-Pro-Gln-Leu; MW: 2062.22] @PN=ADI-SP-101375-1
product: 2B-(S) [Biotin-Arg-Arg-Ala-Ala-Gly-Gly-Leu-asp-Ser-Arg-Ala-Gly-Ser-Pro-Gln-Leu-OH; MW: 2000.24] @PN=ADI-SP-55158-1
product: 2B/3, Dengue Protease Substrate [Ac-Glu-Val-Lys-Lys-Gln-Arg- pNA; MW: 949.09] @PN=ADI-SP-100797-1
product: 2pc syringe 10 ml @PN=301783
product: 2pc syringe 2 ml @PN=301784
product: 2pc syringe 5 ml @PN=301781
product: 3' End Labeling System (TdT) @PN=MB-9002
product: 3,6,9,12-TETRAOXATETRADECANE-1,14-DIYL D @PN=91044
product: 3,6,9-TRIOXAUNDECANE-1,11-DIYL DIMETHANE @PN=91043
product: 3,6-DIOXAOCTANE-1,8-DIYL DIMETHANETHIOSU @PN=91042
product: 3/4A, Dengue Protease Substrate [Ac-Phe-Ala-Ala-Gly-Arg-Lys- pNA; MW: 810.9] @PN=ADI-SP-100800-1
product: 30 bp random library with flanking sequence; DNA aptamer @PN=ADI-DAL-N-30
product: 4-(4-(Dimethylamino)-styryl)-N-methylpyridinium iodide (4-Di-1-ASP) @PN=70006
product: 4-BROMO A-23187 FREE ACID @PN=59006
product: 4-Hydroxynonenal (HNE)-BSA protein conjugate for Western blots (in sample buffer) @PN=ADI-HNE11-C
product: 4-Hydroxynonenal:BSA (HNE, C9H16O2)Protein, Recombinant (E. coli), 156.200 kDa @PN=ADI-HNE15-R
product: 4-Hydroxynonenal:UC (HNE), Protein Control @PN=ADI-HNE12-C
product: 4-Hydroxynonenal:UC (HNE, C9H16O2)Protein, Recombinant (E. coli), 156.200 kDa, Purity: >98% @PN=ADI-HNE51-1
product: 4-Hydroxynonenal:UC (HNE, C9H16O2)Protein, Recombinant (E. coli), 156.200 kDa, Purity: >98% @PN=ADI-HNE51-5
product: 4-hydroxyperoxy 2-nonenal, >98% pure @PN=ADI-HNE52-1
product: 40 bp random library with flanking sequence; DNA aptamer @PN=ADI-DAL-N-40
product: 4A/4B, 5A/5B Peptide [Ac-Asp-Glu-Met-Glu-Glu-Cys-Ser-Met-Ser-Tyr-NH2; MW: 1264.38] @PN=ADI-SP-88150-5
product: 4A/4B, Peptide (1) [Asp-Glu-Met-Glu-Glu-Cys-Ser-Gln-His-Leu-Pro-Tyr-Ile; MW: 1593.76] @PN=ADI-SP-88149-5
product: 4B/5A, Peptdie [Glu-Cys-Thr-Thr-Pro-Cys-Ser-Gly-Ser-Trp-Leu-Arg-Asp; MW: 1454.60] @PN=ADI-SP-88151-5
product: 5' End Labeling System-Kit @PN=MB-9001
product: 5(6)-CARBOXYRHODAMINE 110-C5-MALEIMIDE ( @PN=91029
product: 5(6)-CFDA (5-(AND-6)-CARBOXYFLUORESCEIN @PN=51014
product: 5(6)-CFDA, SE (5-(AND-6)-CARBOXYFLUORESC @PN=90041
product: 5(6)-FAM SE (FULL CHEMICAL NAME: 5-(AND- @PN=90024
product: 5(6)-ROX CADAVERINE TFA SALT @PN=90108
product: 5(6)-ROX maleimide @PN=91055
product: 5(6)-Tetramethylrhodamine maleimide @PN=91054
product: 5,5'-DIBRMO BAPTA, TETRAPOTASSIUM SALT @PN=50004
product: 5,5'-DIFLUORO BAPTA, AM ESTER @PN=50005
product: 5,5'-DIFLUORO BAPTA, TETRAPOTASSIUM SALT @PN=50006
product: 5,5'-DIMETHYL BAPTA, AM ESTER @PN=50007
product: 5,5'-DIMETHYL BAPTA, TETRAPOTASSIUM SALT @PN=50008
product: 5-(&6)-CARBOXY-2',7'-DICHLOROFLUORESCEIN @PN=51016
product: 5-(&6)-CARBOXY-2',7'-DICHLOROFLUORESCEIN @PN=51015
product: 5-(AND-6)-CARBOXY-2',7'-DICHLOROFLUORESC @PN=90040
product: 5-(AND-6)-CARBOXY-X-RHODAMINE, SUCCINIMI @PN=90005
product: 5-(AND-6)-CARBOXY-X-RHODAMINE, TRIETHYLA @PN=90004
product: 5-(AND-6)-CARBOXYFLUORESCEIN @PN=51013
product: 5-(AND-6)-CARBOXYRHODAMINE 110, HYDROCHL @PN=90000
product: 5-(AND-6)-CARBOXYRHODAMINE 110, SUCCINIM @PN=90001
product: 5-(AND-6)-CARBOXYRHODAMINE 110-X, HYDROC @PN=90002
product: 5-(AND-6)-CARBOXYRHODAMINE 110-X, SUCCIN @PN=90003
product: 5-(AND-6)-CARBOXYTETRAMETHYLRHODAMINE SU @PN=90022
product: 5-(AND-6)-CARBOXYTETRAMETHYLRHODAMINE, M @PN=90027
product: 5-(AND-6-)-((N-(5-AMINOPENTYL)AMINO)CARB @PN=92001
product: 5-AMINOALLYL-DUTP SODIUM SALT LYOPHILI @PN=40020-1
product: 5-AMINOALLYL-DUTP, SODIUM SALT, 10 MM IN @PN=40020
product: 5-AMINOALLYL-UTP, SODIUM SALT, 10 MM IN @PN=40021
product: 5-AMINOALLYL-UTP, SODIUM SALT, LYOPHILIZ @PN=40021-1
product: 5-BROMO-2#-DEOXYURIDINE (BRDU) @PN=40024
product: 5-BROMO-2#-DEOXYURIDINE-5#-TRIPHOSPHATE, @PN=40025
product: 5-Bromo-5-nitro-1,3-dioxane (BAND) @PN=ADI-ABT-810-01
product: 5-Bromo-5-nitro-1,3-dioxane (BND) @PN=ADI-ABT-810-10
product: 5-BROMOURIDINE-5#-TRIPHOSPHATE, 10 MM IN @PN=40026
product: 5-CARBOXY-2',7'-DICHLOROFLUORESCEIN (SIN @PN=51017
product: 5-CARBOXY-2',7'-DICHLOROSULFONEFLUORESCE @PN=51023
product: 5-CARBOXY-X-RHODAMINE, SE (5-ROX, SE) @PN=90036
product: 5-CARBOXY-X-RHODAMINE, TRIETHYLAMMONIUM @PN=90006
product: 5-CARBOXY-X-RHODAMINE-PEO12-PROPIONATE @PN=90090
product: 5-CARBOXY-X-RHODAMINE-PEO8-PROPIONATE S @PN=90089
product: 5-CARBOXYFLUORESCEIN, SE (5-FAM, SE) @PN=90029
product: 5-CARBOXYRHODAMINE 110, SE (5-CR110, SE) @PN=90030
product: 5-CARBOXYRHODAMINE 110-PEO12-PROPIONATE @PN=90086
product: 5-CARBOXYRHODAMINE 110-PEO8-PROPIONATE @PN=90084
product: 5-CARBOXYRHODAMINE 6G, HYDROCHLORIDE, SI @PN=90012
product: 5-CARBOXYRHODAMINE 6G, SE (5-CR 6G, SE) @PN=90032
product: 5-CARBOXYTETRAMETHYLRHODAMINE, SE (5-TAM @PN=90034
product: 5-CARBOXYTETRAMETHYLRHODAMINE, SINGLE IS @PN=90009
product: 5-CARBOXYTETRAMETHYLRHODAMINE-PEO12-PROP @PN=90088
product: 5-CFDA (5-CARBOXYFLUORESCEIN DIACETATE, @PN=51018
product: 5-CR110-PEO3-AMINE TFA SALT @PN=90106
product: 5-CR110-PEO4-PROPIONATE SUCCINIMIDYL EST @PN=90081
product: 5-CR110-X, SE @PN=90014
product: 5-CYANO-2.3-DITOLYL TETRAZOLIM CHLORIDE @PN=10063
product: 5-FAM (5-CARBOXYFLUORESCEIN) @PN=51019
product: 5-FAM-PEO12 SE (5-CARBOXYFLUORESCEIN-PEO @PN=90093
product: 5-FAM-PEO8 SE (5-CARBOXYFLUORESCEIN-PEO8 @PN=90085
product: 5-SFX (6-(FLUORESCEIN-5-CARBOXAMIDO)HEXA @PN=90095
product: 5-TAMRA-PEO3-AMINE @PN=90107
product: 5-Tetramethylrhodamine-dUTP, 1mM in pH=7.5 Tris-HCl buffer @PN=40001
product: 5A/5B, Peptide (1) [Glu-Asp-Val-Val-Abu-Cys-Ser-Met-Ser-Tyr; MW: 1117.24] @PN=ADI-SP-101346-5
product: 5A/5B, Peptide (3) [Ac-Glu-Glu-Val-Val-Ala-Cys-pNA; MW: 810.9] @PN=ADI-SP-101347-1
product: 5x ELISA COATING BUFFER @PN=LBU030A
product: 5x ELISA COATING BUFFER @PN=LBU030B
product: 5x ELISA COATING BUFFER @PN=LBU030C
product: 5X Passive Lysis Buffer @PN=99912
product: 6-(FLUORESCEIN-5-(AND-6)-CARBOXAMIDO) HE @PN=90044
product: 6-CARBOXY-X-RHODAMINE, SE (6-ROX, SE) @PN=90037
product: 6-CARBOXY-X-RHODAMINE, TRIETHYLAMMONIUM @PN=90007
product: 6-CARBOXYFLUORESCEIN, SE (6-FAM, SE) @PN=90023
product: 6-CARBOXYRHODAMINE 110, SE (6-CR110, SE) @PN=90031
product: 6-CARBOXYRHODAMINE 6G, HYDROCHLORIDE, SI @PN=90011
product: 6-CARBOXYRHODAMINE 6G, SE (6-CR 6G, SE) @PN=90033
product: 6-CARBOXYTETRAMETHYLRHODAMINE, SE (6-TAM @PN=90035
product: 6-CARBOXYTETRAMETHYLRHODAMINE, SINGLE IS @PN=90008
product: 6-CFDA (6-CARBOXYFLUORESCEIN DIACETATE, @PN=51021
product: 6-CR110-X, SE @PN=90015
product: 6-FAM (6-CARBOXYFLUORESCEIN) @PN=51020
product: 6-ROX SE IN DMSO AT 83MG/ML (0.13M) @PN=90098
product: 6-ROX, FREE ACID @PN=90013
product: 6-SFX (6-(FLUORESCEIN-6-CARBOXAMIDO)HEXA @PN=90096
product: 6-TAMRA SE IN DMSO AT 90MG/ML (0.17M) @PN=90097
product: 6X GelRed Prestain Buffer with Blue Tracking Dyes @PN=41009
product: 6X GelRed Prestain Buffer with Orange Tracking Dye @PN=41010
product: 7-AAD (7-AMINOACTINOMYCIN D) @PN=40037
product: 7-AMINO-4-METHYLCOUMARIN, N-CBZ-L-ASPART @PN=10202
product: 7-AMINO-4-METHYLCOUMARIN, N-CBZ-L-PHENYL @PN=10201
product: 7-NITROINDAZOLE (7-NI) @PN=00240
product: 8-Hydroxy Guanosine compound:UC (8-Oxoguanosine, C10H13N5O6)299.200 kDa, Purity >99% @PN=ADI-8OHG15-N-1
product: 8-Hydroxy Guanosine compound:UC (8-Oxoguanosine, C10H13N5O6)299.200 kDa, Purity >99% @PN=ADI-8OHG15-N-5
product: 8-Hydroxy-2-deoxy Guanosine:UC compound, Purified Protein Control, Purity >98% @PN=ADI-8OH2G16-N-5
product: 8-Hydroxy-2-deoxy Guanosine:UC compound, Purified, Protein Control, Purity >98% @PN=ADI-8OH2G16-N-1
product: ?- Bag Cell Peptide [Arg-Leu-Arg-Phe-Asp (MW: 705.82)] @PN=ADI-SP-88224-5
product: ?-MSH (3-8) [Met-Gly-His-Phe-Arg-Trp (MW: 832.98)] @PN=ADI-SP-101847-5
product: ?-TAC4 (30 - 61) - NH2 [Thr-Glu-Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys-Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu-Met-NH2 (MW: 3481.96)] @PN=ADI-SP-86686-1
product: ?-TAC4 (32 - 50) [Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys (MW: 2084.33)] @PN=ADI-SP-86685-1
product: A kit containing all affinity purification buffers for 10-20 antibody purifications @PN=ADI-110300-AF
product: a- Bag Cell Peptide (1 - 8) [Ala-Pro-Arg-Leu-Arg-Phe-Tyr-Ser (MW: 1009.19)] @PN=ADI-SP-88222-5
product: A-18-F-NH2; Morphine Modulating Neuropeptide [Ala-Gly-Glu-Gly-Leu-Ser-Ser-Pro-Phe-Trp-Ser-Leu-Ala-Ala-Pro-Gln-Arg-Phe-NH2 (MW: 1920.7)] @PN=ADI-SP-89042-1
product: A-20 Cell Slide (BALB/cAnN mouse, B lymphocyte, reticulum cell sarcoma) (5 slides/pk) @PN=ADI-MCLS-17208
product: A-23187 FREE ACID (CALCIMYCIN, OR CALCI @PN=59001
product: A-431 Cell Slide (Human (85 yrs, Female) skin epidermoid carcinoma) (5 slides/pk) @PN=ADI-HCLS-17002
product: A-779 [H-Asp-Arg-Val-Tyr-Ile-His-D-Ala-OH; MW: 872.99] @PN=ADI-SP-55258-1
product: A-A-A-Y-G-G-F-L [Ala-Ala-Ala-Tyr-Gly-Gly-Phe-Leu (MW: 768.87)] @PN=ADI-SP-88440-5
product: a-ANF (1-28), Human [Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cus-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MW: 3080.46] @PN=ADI-SP-52223-1
product: a-Bag Cell Peptide (1 - 7) [Ala-Pro-Arg-Leu-Arg-Phe-Tyr (MW: 922.11)] @PN=ADI-SP-88221-5
product: a-Bag Cell Peptide (1 - 9) [Ala-Pro-Arg-Leu-Arg-Phe-Tyr-Ser-Leu (MW: 1122.35)] @PN=ADI-SP-88223-5
product: a-Casein (90-95) [Arg-Tyr-Leu-Gly-Tyr-Leu (MW: 2367.83)] @PN=ADI-SP-87477-5
product: a-Casomorphin (1-2) [Tyr-Pro (MW: 278.31)] @PN=ADI-SP-55314-5
product: a-CGRP (19 - 37), human [Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2] @PN=ADI-SP-88241-1
product: a-CGRP (23-37) (human) [Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 (MW: 1620.89)] @PN=ADI-SP-89401-1
product: a-CGRP (29-37) (canine, mouse, rat) [Pro-Thr-Asn-Val-Gly-Ser-Glu-Ala-Phe-NH2 (MW: 920.00)] @PN=ADI-SP-89403-5
product: a-CGRP (30-37) (canine, mouse, rat) [Thr-Asn-Val-Gly-Ser-Glu-Ala-Phe-NH2 (MW: 822.88)] @PN=ADI-SP-89404-5
product: a-CGRP (31-37) (canine, mouse, rat) [Asn-Val-Gly-Ser-Glu-Ala-Phe- NH2 (MW: 721.77)] @PN=ADI-SP-89405-5
product: a-CGRP (32-37) (canine, mouse, porcine, rat) [Val-Gly-Ser-Glu-Ala-Phe-NH2 (MW: 607.67)] @PN=ADI-SP-89406-5
product: a-CGRP (33-37) (canine, mouse, porcine, rat) [Gly-Ser-Glu-Ala-Phe-NH2 (MW: 508.54)] @PN=ADI-SP-87407-5
product: a-Conotoxin EI (AA: Arg-Asp-Hyp-Cys-Cys-Tyr-His-Pro-Thr-Cys-Asn-Met-Ser-Asn-Pro-Gln-Ile-Cys- NH2) (MW: 2091.39) @PN=ADI-SP-103040-1
product: a-Conotoxin GS (AA: Ala-Cys-Ser-Gly-Arg-Gly-Ser-Arg-Cys-Hyp-Hyp-Gln-Cys-Cys-Met-Gly-Leu-Arg-Cys-Gly-Arg-Gly-Asn-Pro-Gln-Lys-Cys-Ile-Gly-Ala-His-Gla-Asp-Val) (MW: 3624.11) @PN=ADI-SP-103042-1
product: a-Conotoxin MI (AA: Gly-Arg-Cys-Cys-His-Pro-Ala-Cys-Gly-Lys-Asn-Tyr-Ser-Cys- NH2) (MW: 1497.74) @PN=ADI-SP-103044-1
product: a-Conotoxin SI [Ile-Cys-Cys-Asn-Pro-Ala-Cys-Gly-Pro-Lys-Tyr-Ser-Cys- NH2 (Disulfide bridges: Cys2-Cys7, Cys3-Cys13 ) (MW: 1353.6)] @PN=ADI-SP-101853-5
product: a-Conotoxin SIA (AA: Tyr-Cys-Cys-His-Pro-Ala-Cys-Gly-Lys-Asn-Phe-Asp-Cys-NH2 (Disulfide bridge: Cys2 -Cys7,Cys3 - Cys13)) (MW: 1455.7) @PN=ADI-SP-102111-1
product: a-Defensin-1 human @PN=ADI-SP-88391-1
product: A-F-A [Ala-Phe-Ala (MW: 307.35)] @PN=ADI-SP-84995-5
product: A-G-D-V peptide [H-Ala-Gly-Asp-Val-OH; MW: 360.37] @PN=ADI-SP-55170-5
product: a-Gliadin (57-73) [Gln-Leu-Gln-Pro-Phe-Pro-Gln-Pro-Glu-Leu-Pro-Tyr-Pro-Gln-Pro-Gln-Ser (MW: 1994.25)] @PN=ADI-SP-58780-1
product: a-Gliadin (57-89) [Ac-LQL QPF PQP ELP YPQ PQL PYP QPQ LPY PQP QPF-NH2; mol wt 3953.5), 33-aa, deamidated antigen for celiac disease @PN=ADI-SP-89924-1
product: A-H-A [Ala-His-Ala (MW: 297.32)] @PN=ADI-SP-84987-5
product: a-Helical CRF (12-41) [Phe-His-Leu-Leu-Arg-Glu-Met-Leu-Glu-Met-Ala-Lys-Ala-Glu-Gln-Glu-Ala-Glu-Gln-Ala-Ala-Leu-Asn-Arg-Leu-Leu-Leu-Glu-Glu-Ala-NH2 (MW: 3497.08)] @PN=ADI-SP-89540-1
product: a-Helical CRF (9-41) [Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Met-Leu-Glu-Met-Ala-Lys-Ala-Glu-Gln-Glu-Ala-Glu-Gln-Ala-Ala-Leu-Asn-Arg-Leu-Leu-Leu-Glu-Glu-Ala-NH2 (MW: 3826.44)] @PN=ADI-SP-89539-1
product: A-K-R-R-R-L-S-S-L-R-A [H-Ala-Lys-Arg-Arg-Arg-Leu-Ser-Ser-Leu-Arg-Ala-OH; MW: 1313.58] @PN=ADI-SP-55368-1
product: A-L-A [Ala-Leu-Ala (MW: 273.33)] @PN=ADI-SP-84992-5
product: A-L-A-L peptide [H-Ala-Leu-Ala-Leu-OH; MW: 386.5] @PN=ADI-SP-87356-1
product: a-Mating Factor (1-6) [Trp-His-Trp-Leu-Gln-Leu (MW: 882.04)] @PN=ADI-SP-88495-5
product: a-Melanocyte Stimulating Hormone (11-13)(MSHa) [Lys-Pro-Val-NH2 (MW: 341.46)] @PN=ADI-SP-103045-5
product: a-Melanocyte Stimulating Hormone [Acetyl-D-Lys11, D-Val13] (11-13) (MSHa) [Ac-D-Lys-Pro-D-Val-NH2 (MW: 383.49)] @PN=ADI-SP-103046-5
product: a-Melanocyte Stimulating Hormone [Met5, Pro6, D-Phe7, D-Trp9, Phe10] (5-13) (MSHa) [Met-Pro-D-Phe-Arg-D-Trp-Phe-Lys-Pro-Val-NH2 (MW: 1206.53)] @PN=ADI-SP-58173-5
product: a-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa) [Ac-Lys-Pro-D-Val-NH2 (MW: 383.49)] @PN=ADI-SP-103047-5
product: a-MSH [AC-Ser-tyr-ser-met-glu-his-phe-arg-trp-gly-lys-pro-val-NH2; MW 1664.9] @PN=ADI-SP-52274-5
product: a-MSH, Free Acid [Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val (MW: 1665.91)] @PN=ADI-SP-86549-5
product: a-Neo-Endorphin (1-7) [Tyr-Gly-Gly-Phe-Leu-Arg-Lys (MW: 840)] @PN=ADI-SP-87434-5
product: a-Neo-Endorphin Analog [Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr-Arg-Pro-Lys-NH2 (MW: 1383.68)] @PN=ADI-SP-87433-5
product: a-Neo-Endorphin, porcine [Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr-Pro-Lys (MW: 1228.47)] @PN=ADI-SP-87431-5
product: a-Neoendorphin (1-8) [Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr (MW: 1003.17)] @PN=ADI-SP-100053-5
product: a-Substance IB [Arg-Gly-Pro-Phe-Pro-Ile (MW: 685.82)] @PN=ADI-SP-102050-5
product: A-VI-5 [Val-Glu-Ser-Ser-Lys (MW: 548.60)] @PN=ADI-SP-86486-5
product: A549 Cell Slide (Human (58 yrs, Male) lung carcinoma) (5 slides/pk) @PN=ADI-HCLS-17003
product: AAV Testing Kit @PN=7050
product: AAV-Cre-CRE (Ad 5) @PN=1045
product: AAV-Cre-CRE (Ad 5)(high titer) @PN=1045HT
product: AAV-Cre-CRE (Ad 5)(high titer) @PN=1045HT-01
product: AAV-Cre-GFP (AAV serotype-2) @PN=7016
product: AAV-DJ-ALB(1.9)-EGFP; (10^13 GC/ml) @PN=VB1586
product: AAV-DJ-ALB(1.9)-iCre; (10^13 GC/ml) @PN=VB1570
product: AAV-GFP (AAV serotype 2) @PN=7004
product: AAV1-Cre @PN=7010
product: AAV1-Cre-GFP @PN=7015
product: AAV1-GFP @PN=7002
product: AAV1-GFP-U6-shRNA @PN=7040
product: AAV1-LacZ @PN=7001
product: AAV2-Cre @PN=7011
product: AAV2-GFP-U6-shRNA @PN=7041
product: AAV2-LacZ @PN=7003
product: AAV2-Null @PN=7026
product: AAV5-Cre @PN=7012
product: AAV5-GFP @PN=7006
product: AAV5-GFP-U6-shRNA @PN=7042
product: AAV5-LacZ @PN=7005
product: AAV5-Null @PN=7028
product: AAV6 Null @PN=7029
product: AAV6-Cre-GFP @PN=7019
product: AAV6-GFP @PN=7008
product: AAV6-GFP-U6-shRNA @PN=7043
product: AAV8-ALB-mHFE-FLAG @PN=AAV-261266
product: Abarelix (Acetyl-Ser-Leu-Pro-NH2; MW:1416.06) @PN=ADI-PP-1000
product: ABD-F @PN=91046
product: abII probe [Ser-Ala-Pro-Arg-Ala-Thr-Ile-Ser-His-Tyr-Leu-Met-Gly-Gly (MW: 1460.69)] @PN=ADI-SP-86868-5
product: abIII probe [Ser-Ser-Trp-Asp-Met-His-Gln-Phe-Phe-Trp-Glu-Gly-Val-Ser-Arg (MW: 1899.09)] @PN=ADI-SP-86867-1
product: Abl Cytosolic Substrate [Glu-Ala-Ile-Tyr-Ala-Ala-Pro-Phe-Ala-Lys-Lys-Lys (MW: 1336.61)] @PN=ADI-SP-53571-1
product: Abltide [Lys-Lys-Gly-Glu-Ala-Ile-Tyr-Ala-Ala-Pro-Phe-Ala-NH2 (MW: 1264.50)] @PN=ADI-SP-86721-5
product: Abrin Toxin, DNA Aptamer, Biotinylated @PN=ADI-AD-101-B
product: Abrin Toxin, DNA Aptamer, FITC labeled @PN=ADI-AD-101-F
product: Abrin Toxin, DNA Aptamer, unlabeled @PN=ADI-AD-101-U
product: Abscisic Acid:AP (ABA), Phytodetek ELISA Kit, Mono/Mono, Competitve ELISA @PN=PDK09347-0096
product: Abscisic Acid:AP (ABA), Phytodetek Tracer @PN=PDA09347-0032
product: Abscisic Acid:UC (ABA), Monoclonal, Phytodetek Antibody @PN=PDM09347-0096
product: Abthrax/Raxibacumab ELISA Kit, 96 tests, quantitative @PN=ADI-900-175-ABG
product: Abthrax/Raxibacumab ELISA Kit, 96 tests, quantitative @PN=ADI-900-190-OBG
product: Abthrax/Raxibacumab identification/Counterfeit detection ELISA Kit, 24 tests @PN=ADI-900-175-ID24
product: Abthrax/Raxibacumab identification/Counterfeit detection ELISA Kit, 24 tests @PN=ADI-900-190-ID24
product: ABTSTM (2,2' -AZINO-BIS-(3-ETHYLBENZOTHI @PN=10050
product: Ac - 5A/5B Peptide [Ac-Glu-Asp-Val-Val-Cys-Cys-Ser-Met-Ser-Tyr-NH2 (MW: 1176.34)] @PN=ADI-SP-88152-5
product: Ac- [Nle4,DPhe7] a-MSH (4-10), amide [Ac-Nle-Glu-His-D-Phe-Arg-Trp-Gly-NH2 (MW: 985.12)] @PN=ADI-SP-88490-1
product: Ac-a-CGRP (19-37) (human) [Ac-Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 (MW: 1963.24)] @PN=ADI-SP-89400-1
product: Ac-ACTH (1-14), 10-1-12A [Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly (MW: 1722.96)] @PN=ADI-SP-86491-1
product: Ac-ACTH (1-17) [Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg (MW: 2135.50)] @PN=ADI-SP-86493-1
product: Ac-Adhesin (1025-1044) amide [Ac-Gln-Leu-Lys-Thr-Ala-Asp-Leu-Pro-Ala-Gly-Arg-Asp-Glu-Thr-Thr-Ser-Phe-Val-Leu-Val- NH2 (MW: 2202.51)] @PN=ADI-SP-86487-1
product: Ac-Amylin (8-37), human [Ac-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Ala-Ile-Leu-Ser-Ser-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (MW: 3225.55)] @PN=ADI-SP-89378-1
product: Ac-Amylin (8-37), rat [Ac-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (MW: 3242.67)] @PN=ADI-SP-87931-1
product: Ac-Amyloid ß-Protein (15-20) amide [Ac-Gln-Lys-Leu-Val-Phe-Phe- NH2 (MW: 822.03)] @PN=ADI-SP-89301-5
product: Ac-Angiotensinogen (1-14), human [Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Asn (MW: 1802.1)] @PN=ADI-SP-101677-1
product: Ac-Angiotensinogen (1-14), porcine [Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser (MW: 1801.1)] @PN=ADI-SP-101680-1
product: Ac-Calpastatin (184-210) (human) [Ac-Asp-Pro-Met-Ser-Ser-Thr-Tyr-Ile-Glu-Glu-Leu-Gly-Lys-Arg-Glu-Val-Thr-Ile-Pro-Pro-Lys-Tyr-Arg-Glu-Leu-Leu-Ala-NH2 (MW: 3177.68)] @PN=ADI-SP-89408-1
product: Ac-Choline Receptor a1(129-145) [Glu-Ile-Ile-Val-Thr-His-Phe-Pro-Phe-Asp-Glu-Gln-Asn-Cys-Ser-Met-Lys (MW: 2038.34)] @PN=ADI-SP-86488-1
product: Ac-D-E peptide [Ac-Asp-Glu-OH; MW: 304.3] @PN=ADI-SP-55348-5
product: Ac-d-Endorphin (bovine, camel, mouse, ovine) [Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His (MW: 3038.54)] @PN=ADI-SP-89899-1
product: Ac-DEVD-CHO, Caspase-3 Inhibitor @PN=10404-1
product: Ac-DEVD-CHO, Caspase-3 Inhibitor @PN=10404
product: Ac-Endothelin-1 (16-21), human [Ac-His-Leu-Asp-Ile-Ile-Trp (MW: 837.98)] @PN=ADI-SP-88402-5
product: Ac-g-Endorphin [Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu (MW: 1901.18)] @PN=ADI-SP-87429-1
product: Ac-Glutamine [Ac-Gln (MW: 188.18)] @PN=ADI-SP-86674-5
product: Ac-GPK(Ac)-Pna [Ac-Gly-Pro-Lys(Ac)pNA; MW:504.5] @PN=ADI-SP-52003-25
product: Ac-GPK-pNA [Ac-Gly-Pro-Lys-pNA; MW: 462.5] @PN=ADI-SP-52004-5
product: Ac-GPK-pNA [Ac-Gly-Pro-Lys-pNA; MW: 462.5] @PN=ADI-SP-52004-25
product: Ac-GRP (20-26) (human, porcine, canine) [Ac-His-Trp-Ala-Val-Gly-His-Leu- NH2 (MW: 859-99)] @PN=ADI-SP-100263-5
product: Ac-Hirudin (55-65) (desulfated) [Ac-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-Gln (MW: 1453.53)] @PN=ADI-SP-89129-1
product: Ac-IEAR-Pna [Ac-Ile-Glu-Ala-Arg-pNA; MW:649.7] @PN=ADI-SP-51614-25
product: Ac-IETD-pNA [Ac-Ile-Glu-Thr-Asp-pNA; MW:638.6] @PN=ADI-SP-52001-25
product: Ac-LEHD* [Ac-Leu-Glu-His-Asp-pNA:, MW 674.7] @PN=ADI-SP-51999-1
product: Ac-MBP (4-14) Peptide [Ac-Gln-Lys-Arg-Pro-Ser-Gln-Arg-Ser-Lys-Tyr-Leu (MW: 1432.7)] @PN=ADI-SP-102039-5
product: Ac-Neurotrophin Receptor (368-381) amide (human) [Ac-Ala-Thr-Leu-Asp-Ala-Leu-Leu-Ala-Ala-Leu-Arg-Arg-Leu-Gln-NH2 (MW: 1565.89)] @PN=ADI-SP-86489-1
product: Ac-P-G-A [Ac-Pro-Gly-Ala (MW: 285.30)] @PN=ADI-SP-70164-5
product: Ac-PACAP-38 (human, mouse, ovine, porcine, rat) @PN=ADI-SP-100455-1
product: Ac-Pepstatin [Ac-Val-Val-Sta-Ala-Sta (MW: 471.56)] @PN=ADI-SP-86490-10
product: Ac-Phe-Gly-pNA [Ac-Phe-Gly-pNA (MW: 384.40)] @PN=ADI-SP-88496-5
product: Ac-RYYRIK-NH2 [Ac-Arg-Tyr-Tyr-Arg-Ile-Lys-NH2 (MW: 939.14)] @PN=ADI-SP-89054-5
product: Ac-S-D-K-P* [Ac-Ser-Asp-Lys-Pro-OH; MW: 487.51] @PN=ADI-SP-51961-1
product: Ac-VEID-pNA* [Ac-Val-Glu-Ile-Asp-pNA; MW:636.6] @PN=ADI-SP-52000-25
product: Ac-YVAD-pNA* [Ac-Tyr-Val-Ala-Asp-pNA; MW:628.6] @PN=ADI-SP-51978-25
product: Ac-[Asn30,Tyr32]-Calcitonin (8-32) (salmon I) [Ac-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Asn-Thr-Tyr-NH2 (MW: 2890.27)] @PN=ADI-SP-89396-1
product: Ac-[Cys(Acm)33,42]-EGF (33-42) amide (mouse) [Ac-Cys(Acm)-Val-Ile-Gly-Tyr-Ser-Gly-Asp-Arg-Cys(Acm)-NH2 (MW: 1255.45)] @PN=ADI-SP-100294-5
product: Ac-[D-Lys2,Sar3]-Melanotropin-Potentiating Factor [Ac-Lys-D-Lys-Sar-Glu (MW: 516.60)] @PN=ADI-SP-89894-5
product: Ac-[DTrp16] Endothelin-1 (16-21), human [Ac-D-Trp-Leu-Asp-Ile-Ile-Trp (MW: 887.03)] @PN=ADI-SP-88426-5
product: Ac-[Leu28,31]-Neuropeptide Y (24-36) [Ac-Leu-Arg-His-Tyr-Leu-Asn-Leu-Leu-Thr-Arg-Gln-Arg-Tyr-NH2 (MW: 1787.1)] @PN=ADI-SP-100076-5
product: Ac-[Lys0,Nle3]-g2-MSH amide [Ac-Lys-Tyr-Val-Nle-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2 (MW: 1722.00)] @PN=ADI-SP-88486-5
product: Ac-[Pro18, Asp21] ß- Amyloid (17 - 21), amide, iAb5p Pro18 Asp21 [Ac-Leu-Pro-Phe-Phe-Asp-NH2 (MW: 678.79)] @PN=ADI-SP-87940-5
product: Ac-[Tyr1,D-Arg2]-GRF (1-29) amide (human) [Ac-Tyr-D-Arg-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 (MW: 3485.10)] @PN=ADI-SP-89083-1
product: Ac-[Tyr1,D-Phe2]-GRF (1-29) amide (human) [Ac-Tyr-D-Phe-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 (MW: 3476.09)] @PN=ADI-SP-89084-1
product: Ac-ß- Endorphin, bovine, camel, ovine [Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln (MW: 3480.1)] @PN=ADI-SP-100526-1
product: Ac-ß-Endorphin (human) [Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu (MW: 3507.10)] @PN=ADI-SP-89895-1
product: ACCUBLUE BROAD DSDNA QUANT KIT 1000 RX @PN=31007
product: ACCUBLUE BROAD DSDNA QUANT SOLUTION @PN=31009
product: ACCUBLUE BROAD DSDNA QUANT SOLUTION SMP @PN=31009-T
product: AccuBlue Broad Range dsDNA Quantitation Kit with DNA Standard, trial size (200 assays) @PN=31007-T
product: AccuBlue Broad Range dsDNA Quantitation Standards, set of nine, 0.5 mL each @PN=31007C
product: ACCUBLUE HIGH SENS DSDNA QUANT KIT 500 @PN=31006
product: ACCUBLUE HIGH SENS DSDNA QUANT SOLUT SMP @PN=31008-T
product: ACCUBLUE HIGH SENSDSDNA QUANT SOLUTION @PN=31008
product: AccuBlue High Sensitivity dsDNA Quantitation Kit with DNA Standard, trial size (100 assays) @PN=31006-T
product: AccuBlue High Sensitivity dsDNA Standards, set of eight, 0.5 mL each @PN=31006C
product: ACCUBLUE NEXTGEN DSDNA QUANT SOLUTION @PN=31061
product: ACCUBLUE NEXTGEN DSDNA QUANT SOLUTION @PN=31061-T
product: ACCUBLUE NEXTGEN DSDNA QUANTITATION KIT @PN=31060
product: ACCUBLUE NEXTGEN DSDNA QUANTITATION KIT @PN=31060-T
product: AccuClear Ultra High Sensitivity dsDNA Quantitation Assay kit with 1 DNA Standard (4000 assays) @PN=31029
product: AccuClear Ultra High Sensitivity dsDNA Quantitation Assay kit with 8 DNA Standards (1000 assays) @PN=31028
product: AccuClear Ultra High Sensitivity dsDNA Quantitation Assay kit with DNA Standard, trial size (200 assays) @PN=31028-T
product: AccuClear Ultra High Sensitivity dsDNA Quantitation Solution (1000 assays) @PN=31027
product: AccuClear Ultra High Sensitivity dsDNA Quantitation Solution, Trial Size (200 assays) @PN=31027-T
product: AccuEasy Flow Cytometry Kit @PN=30069
product: AccuGreen High Sensitivity dsDNA Quantitation Kit (100 assays) @PN=31066-T
product: AccuGreen High Sensitivity dsDNA Quantitation Kit (20 assays) @PN=31066-F
product: AccuGreen High Sensitivity dsDNA Quantitation Kit (500 assays) @PN=31066
product: AccuOrangeT Protein Quantitation Kit, 200 assays @PN=30071-T
product: AccuOrangeT Protein Quantitation Kit, 2000 assays @PN=30071
product: ACE @PN=LIN0100-0313
product: Acetalin 1, Opioid Receptor Antagonist 1 [Ac-Arg-Phe-Met-Trp-Met-Arg- NH2 (MW: 967.23)] @PN=ADI-SP-86609-5
product: Acetalin 3, Opioid Receptor Antagonist 3 [Ac-Arg-Phe-Met-Trp-Met-Thr- NH2 (MW: 912.15)] @PN=ADI-SP-86610-5
product: Acetone pure Ph. EUR., NF, min. 99% @PN=A1600,1000
product: Acetyl Hexapeptide-3 (Ac-Glu-Glu-Met-Gln-Arg-Arg-NH2) @PN=ADI-CP-54947
product: Acetyl, a-Endorphin [Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-OH; MW: 1788.02] @PN=ADI-SP-55161-1
product: Achatin-1 [Gly-D-Phe-Ala-Asp (MW: 407.4)] @PN=ADI-SP-101850-5
product: Acid Phosphatase Test (colorimteric) 100 tests, Quantitative @PN=ADI-1315
product: Acidovorax avenae subsp. citrulli (Aac), ImmunoStrip® @PN=STX14800-0005
product: Acidovorax avenae subsp. citrulli (Aac), ImmunoStrip® Kit @PN=ISK14800-0025
product: Acidovorax avenae subsp. citrulli (Aac), ImmunoStrip® Kit @PN=ISK14800-0005
product: Acidovorax avenae subsp. citrulli (Aac); ImmunoStrip® @PN=STX14800-0025
product: Acidovorax avenae subsp. citrulli:AP (Aac), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA14800-0500
product: Acidovorax avenae subsp. citrulli:AP (Aac), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA14800-1000
product: Acidovorax avenae subsp. citrulli:AP (Aac), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA14800-5000
product: Acidovorax avenae subsp. citrulli:AP (Aac), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA14800-0096
product: Acidovorax avenae subsp. citrulli:AP (Aac), Polyclonal, Conjugated Antibody @PN=ECA14800-1000
product: Acidovorax avenae subsp. citrulli:AP (Aac), Polyclonal, Conjugated Antibody @PN=ECA14800-5000
product: Acidovorax avenae subsp. citrulli:AP (Aac), Polyclonal, Conjugated Antibody @PN=ECA14800-0500
product: Acidovorax avenae subsp. citrulli:UC (Aac), Monoclonal, Coating Antibody @PN=CAB14800-0500
product: Acidovorax avenae subsp. citrulli:UC (Aac), Monoclonal, Coating Antibody @PN=CAB14800-1000
product: Acidovorax avenae subsp. citrulli:UC (Aac), Monoclonal, Coating Antibody @PN=CAB14800-5000
product: Acidovorax avenae subsp. citrulli:UC (Aac), Negative Control @PN=LNC14800
product: Acidovorax avenae subsp. citrulli:UC (Aac), Positive Control @PN=LPC14800
product: ACRIDINE ORANGE 10MG/ML IN WATER @PN=40039
product: Acrinol (>98% pure) @PN=ADI-ABT-680-25
product: ACTH (1-14) [H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-OH; MW: 1680.9] @PN=ADI-SP-55135-1
product: ACTH (1-16), Human [H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH; MW: 1937.27] @PN=ADI-SP-55156-1
product: ACTH (1-17), Human [H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH; MW: 2093.5] @PN=ADI-SP-55159-1
product: ACTH (1-24) (human, bovine, rat), High Sensitivity, CE-marked @PN=S-1185
product: ACTH (1-39) (guinea pig) (AA: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Ala-Asn-Gly-Ala-Glu-Glu-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe) (MW: 4529.16 @PN=ADI-SP-86497-1
product: ACTH (1-4) peptide [H-Ser-Tyr-Ser-Met-OH: MW: 486.6] @PN=ADI-SP-55173-1
product: ACTH (11-24) (AA: Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro) (MW: 1652.08) @PN=ADI-SP-62197-5
product: ACTH (12-39), rat (AA: Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe) (MW: 3172.66) @PN=ADI-SP-87342-1
product: ACTH (18-39) (human) (Adrenocorticotropic Hormone) (Biotin) (AA:Biotin-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe) (MW: 2692.02) @PN=ADI-SP-103048-1
product: ACTH (22-39) (AA: Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe) (MW: 1985.11) @PN=ADI-SP-86548-1
product: ACTH (3-24), human (AA: Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro) (MW: 2683.25) @PN=ADI-SP-86498-1
product: ACTH (34-39) (AA: Ala-Phe-Pro-Leu-Glu-Phe) (MW: 722.85) @PN=ADI-SP-62198-5
product: ACTH (4-11) (AA: Met-Glu-His-Phe-Arg-Trp-Gly-Lys) (MW: 1090.28) @PN=ADI-SP-86545-5
product: ACTH (4-9) (AA: Met-Glu-His-Phe-Arg-Trp) (MW: 905.05) @PN=ADI-SP-86499-5
product: ACTH (6-24), human (AA:His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro) (MW: 2335.9) @PN=ADI-SP-62195-1
product: ACTH (7- 38), human (AA: Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu) (MW: 3659.20) @PN=ADI-SP-86547-1
product: ACTH 1-24 (Adrenocorticotropic Hormone human) (1-24) (Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys- @PN=ADI-PP-1010
product: ACTH(1-10), Human [H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-OH; MW: 1299.4] @PN=ADI-SP-55359-1
product: ACTH(1-13), Human [H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-OH; MW: 1623.9] @PN=ADI-SP-55399-1
product: ACTH(1-24), Human [H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Glu-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH; MW: 2993.5] @PN=ADI-SP-55222-1
product: ACTH(1-39), Human [Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH; MW: 4541.1] @PN=ADI-SP-52315-1
product: ACTH(1-39), Rat [H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Gly-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH; MW: 4582.3] @PN=ADI-SP-55405-1
product: ACTH(18-39), Human [H-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH; MW: 2465.7] @PN=ADI-SP-55215-1
product: ACTH(4-10), Human [H-Met-Glu-His-Phe-Arg-Trp-Gly-OH; MW: 962.1] @PN=ADI-SP-51725-1
product: ACTH(4-9), Tyr (AA: Tyr-Met-Glu-His-Phe-Arg-Trp-Gly) (MW: 1125.28) @PN=ADI-SP-86544-5
product: ACTH(5-10)(AA: Glu-His-Phe-Arg-Trp-Gly) (MW: 830.91) @PN=ADI-SP-80991-5
product: Actin @PN=pro-517A
product: Actin @PN=pro-517B
product: Actin @PN=pro-517C
product: Actinomycin D @PN=40038
product: Activated Charcoal Decontamination Bag @PN=22007
product: Activated Protein C (390-404) (human) [Tyr-Gly-Val-Tyr-Thr-Lys-Val-Ser-Arg-Tyr-Leu-Asp-Trp-Ile-His (MW: 1900.18)] @PN=ADI-SP-86551-1
product: Activated Protein C (APC 9G-70) , RNA Aptamer, unlabeled @PN=ADI-AR-201-U
product: Activity - Dependent Neurotrophic Factor, ADNF [Ser-Ala-Leu-Leu-Arg-Ser-Ile-Pro-Ala (MW: 927.12)] @PN=ADI-SP-87943-5
product: Activity-Dependent Neurotrophic Factor-14 [Val-Leu-Gly-Gly-Gly-Ser-Ala-Leu-Leu-Arg-Ser-Ile-Pro-Ala (MW: 1310.57)] @PN=ADI-SP-86552-5
product: Actylcholine Receptor Antibody (mAB198) (SE RNA VII) , RNA Aptamer, unlabeled @PN=ADI-AR-311-U
product: Acute myeloid leukemia cells (KH1C12), DNA Aptamer, Biotinylated @PN=ADI-AD-102-B
product: Acute myeloid leukemia cells (KH1C12), DNA Aptamer, FITC labeled @PN=ADI-AD-102-F
product: Acute myeloid leukemia cells (KH1C12), DNA Aptamer, unlabeled @PN=ADI-AD-102-U
product: Acyl Carrier Protein (65-74) (acid) [Val-Gln-Ala-Ala-Ile-Asp-Tyr-Ile-Asn-Gly (MW: 1063.18)] @PN=ADI-SP-86553-5
product: Acyl Carrier Protein (65-74) (amide) (AA: Val-Gln-Ala-Ala-Ile-Asp-Tyr-Ile-Asn-Gly-NH2) (MW: 1062.20) @PN=ADI-SP-86554-5
product: Acylase (1000 U/mg material), Porcine kidney @PN=ADI-AC-01
product: Acylase (2000 U/mg material), Porcine kidney @PN=ADI-AC-02
product: Ad-Ab @PN=1472
product: Ad-Ab @PN=1478
product: Ad-Adipo-R1 @PN=1365
product: Ad-Adipo-R2 @PN=1461
product: Ad-AGTR-L1 @PN=1428
product: Ad-AP1-Luc @PN=1670
product: Ad-BCL2 @PN=1412
product: Ad-Bcl2A1 @PN=1377
product: Ad-BIRC2 @PN=1374
product: Ad-BIRC3 @PN=1446
product: Ad-BIRC4/XIAP @PN=1429
product: Ad-BIRC5 @PN=1611
product: Ad-BRCA1 @PN=1351
product: Ad-CBR @PN=1283
product: Ad-Cdc25A @PN=1543
product: Ad-Cdc25B @PN=1553
product: Ad-Cdc25C @PN=1598
product: Ad-CDK5 @PN=1520
product: Ad-CDK7 @PN=1568
product: Ad-CHK1/CHEK1 @PN=1593
product: Ad-CHK2/CHEK2 @PN=1528
product: Ad-CMV-b-Gal @PN=1080
product: Ad-CMV-Caspase 9 (DN) @PN=1044
product: Ad-CMV-CrmA @PN=1032
product: Ad-CMV-FasL @PN=1029
product: Ad-CMV-GFP (Type5, dE1/E3) @PN=1060
product: Ad-CMV-IFN-gamma @PN=1164
product: Ad-CMV-Luc @PN=1000
product: Ad-CMV-Null (Type5, dE1/E3) @PN=1300
product: Ad-CMV-p16 @PN=1040
product: Ad-CMV-p21 @PN=1041
product: Ad-CMV-p27 @PN=1042
product: Ad-CMV-p53 @PN=1168
product: Ad-CMV-Rb @PN=1043
product: Ad-CMV-RNAi @PN=1641
product: Ad-CMV-TLR2 @PN=1142
product: Ad-Cortactin @PN=1594
product: Ad-Cre-GFP (Type5, dE1/E3) @PN=1700
product: Ad-Cre-IRES-GFP @PN=1710
product: Ad-CRE-Luc @PN=1672
product: Ad-CTGF @PN=1352
product: Ad-Cyclin D1 @PN=1517
product: Ad-Cyclin H @PN=1607
product: Ad-DIABLO @PN=1587
product: Ad-ET-1 @PN=1373
product: Ad-FGF21 @PN=1410
product: Ad-GFP-U6-shRNA @PN=1122
product: Ad-h-EMX2 @PN=ADV-207898
product: Ad-h-TGFB1 low titer viral stock for further amplification @PN=ADV-225378
product: Ad-hGRN of untitered seed stock @PN=ADV-210558
product: Ad-hIGFBP3 of untitered seed stock @PN=ADV-211930
product: Ad-IL1(alpha) @PN=1366
product: Ad-IL6 @PN=1380
product: Ad-LEPTIN @PN=1441
product: Ad-m-PLAGL1 @PN=ADV-268798
product: Ad-MCP-1 @PN=1372
product: Ad-Neuregulin-1 @PN=1496
product: Ad-Neuropilin-1 @PN=1554
product: Ad-NFAT-Luc @PN=1665
product: Ad-NFKb-Luc @PN=1740
product: Ad-NOGO-R @PN=1584
product: Ad-Null @PN=1240
product: Ad-p15/MTS2 @PN=1595
product: Ad-p18 @PN=1407
product: Ad-p19/INK4D @PN=1526
product: Ad-p33ING2 @PN=1601
product: Ad-p35 @PN=1385
product: Ad-p53-GFP @PN=1260
product: Ad-p53-Luc @PN=1667
product: Ad-p53-R175H @PN=1261
product: Ad-PDGF-B @PN=1422
product: Ad-PDGF-R(beta) @PN=1420
product: Ad-pRL-Luc @PN=1671
product: Ad-PSR @PN=1471
product: Ad-PTEN @PN=1547
product: Ad-PUMA @PN=1288
product: Ad-PUMA (DBH3) @PN=1289
product: Ad-RFP @PN=1660
product: Ad-SKP2 @PN=1546
product: Ad-SR-1 @PN=1409
product: Ad-SRE-Luc @PN=1668
product: Ad-SRF-Luc @PN=1666
product: Ad-SUMO3 @PN=1571
product: Ad-TARE-luc @PN=1669
product: Ad-TGM2 @PN=1524
product: Ad-TLR4 @PN=1486
product: Ad-TRAIL @PN=1431
product: Ad-TRAILR2 @PN=1356
product: Ad-TSP1 @PN=1488
product: Ad-U6-RNAi @PN=1640
product: Ad-VEGF-B @PN=1550
product: Ad-VEGF-D @PN=1418
product: Ad-VEGF-R1 @PN=1437
product: Ad-VHL @PN=1613
product: Ad-WEE1 @PN=1459
product: Adenine (12E4), RNA Aptamer, unlabeled @PN=ADI-AR-202-U
product: Adenosine, DNA Aptamer, Biotinylated @PN=ADI-AD-103-B
product: Adenosine, DNA Aptamer, FITC labeled @PN=ADI-AD-103-F
product: Adenosine, DNA Aptamer, unlabeled @PN=ADI-AD-103-U
product: Adenosine/ATP (DH25.42), DNA Aptamer, Biotinylated @PN=ADI-AD-104-B
product: Adenosine/ATP (DH25.42), DNA Aptamer, FITC labeled @PN=ADI-AD-104-F
product: Adenosine/ATP (DH25.42), DNA Aptamer, unlabeled @PN=ADI-AD-104-U
product: ADENOVIRUS @PN=LIN0152-0507
product: Adenovirus (strain Adenoid 6) type 2 hexons antigens, purified (host Vero cells) @PN=ADI-ADV66-N
product: Adenovirus (strain Adenoid 6) type 2, semi-pure viral lysate (antigens, host MRC-5 cells) @PN=ADI-ADV65-N
product: ADENOVIRUS TYPE 5 @PN=LMP002
product: Adipokentic Hormone from Schistocera Gregaria [pGlu-Leu-Asn-Phe-Ser-Thr-Gly-Trp-NH2; MW: 934.0] @PN=ADI-SP-52218-1
product: Adipokinetic Hormone (Apis mellifera ligustica, Bombyx mori, Heliothis zea, Manduca sexta) (AA: Glp-Leu-Thr-Phe-Thr-Ser-Ser-Trp-Gly-NH2) (MW: 921) @PN=ADI-SP-100043-5
product: Adipokinetic Hormone [pGlu-Leu-Thr-Phe-Thr-Ser-Trp-Gly-NH2; MW: 921.0] @PN=ADI-SP-55334-1
product: Adipokinetic Hormone, AKH, locust [pGlu-Leu-Asn-Phe-Thr-Pro-Asn-Trp-Gly-Thr-NH2; MW: 1159.3] @PN=ADI-SP-55372-1
product: Adipokinetic Hormone, G (AKH-G) (AA: Pyr-Val-Asn-Phe-Ser-Thr-Gly-Trp-NH2) (MW: 920.02) @PN=ADI-SP-86555-5
product: Adipokintetic, Hormone from Locusta Migratoria [pGlu-Leu-Asn-Phe-Ser-Ala-Gly-Trp; MW: 934.0] @PN=ADI-SP-86563-1
product: ADIPONECTIN @PN=LPH196
product: Adipophilin (AA: Ser-Val-Ala-Ser-Thr-Ile-Thr-Gly-Val) (MW: 833.94) @PN=ADI-SP-60862-5
product: Adjuphos® aluminum phosphate (Th2) Vaccine adjuvant, FDA Approved @PN=ADI-AV-1015-10
product: Adjuphos® aluminum phosphate (Th2) Vaccine adjuvant, FDA Approved @PN=ADI-AV-1015-50
product: ADP - Ribosylation Factor 6, ARF6 (2 - 13) (AA: Gly-Lys-Val-Leu-Ser-Lys-Ile-Phe-Gly-Asn-Lys-Glu) (MW: 1319.58) @PN=ADI-SP-86608-5
product: ADP, RNA Aptamer, unlabeled @PN=ADI-AR-203-U
product: ADP-Ribosylation Factor 1, ARF1 (2 - 17) (AA: Gly-Asn-Ile-Phe-Ala-Asn-Leu-Phe-Lys-Gly-Leu-Phe-Gly-Lys-Lys-Glu) (MW: 1783.12) @PN=ADI-SP-100821-1
product: ADR1 - derived peptide (AA: Leu-Lys-Lys-Leu-Thr-Arg-Arg-Ala-Ser-Phe-Ser-Gly-Gln) (MW: 1491.77) @PN=ADI-SP-54351-5
product: Adrenmedullin(1-52), Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)] @PN=ADI-SP-55426-1
product: Adreno Corticotropic Hormone (ACTH) ELISA Kit, 96 tests, Quantitative @PN=ADI-200-120-ACH
product: Adrenocorticotrophic Hormone:UC @PN=HOR-279A
product: Adrenocorticotrophic Hormone:UC @PN=HOR-279B
product: Adrenocorticotrophic Hormone:UC @PN=HOR-279C
product: Adrenocorticotropic Hormone @PN=ADI-RP-1503
product: Adrenomedullin (1- 52), porcine [(AA: see antigen, sequence too long) (MW: 5971.8)] @PN=ADI-SP-100825-1
product: Adrenomedullin (1-12), human (AA: Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg) (MW: 1513.7) @PN=ADI-SP-100824-5
product: Adrenomedullin (1-50), rat (YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2; Disulfide bridge:Cys14-Cys19 ) (MW: 5729.5) @PN=ADI-SP-100046-1
product: Adrenomedullin (11-50) (rat) @PN=ADI-SP-100047-1
product: Adrenomedullin (16-31) (human, pig) @PN=ADI-SP-100048-1
product: Adrenomedullin (22-52), Human [H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; MW: 3576.06] @PN=ADI-SP-55286-1
product: Adrenomedullin (26-52) (human) (AA: Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2) (MW: 3119.49) @PN=ADI-SP-100049-1
product: Adrenomedullin(13-52), Human @PN=ADI-SP-55425-1
product: Adrenorphin [H-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-NH2; MW: 984.2] @PN=ADI-SP-55322-1
product: Adrenorphin, Free Acid (AA: Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val) (MW: 985.18) @PN=ADI-SP-88439-5
product: Adult Human Tissues (11 ) ReadyBlot tissue Protein Explorer, 1 blot @PN=ADI-HTWB-10
product: Adult Human Tissues (customized tissues) ReadyBlot tissue Protein Explorer, 1 blot @PN=ADI-HTWB-C1
product: Adult Mouse Digestive Tract ReadyBlot Protein Explorer, 1 blot @PN=ADI-MDWB-41
product: Adult Mouse ReadyBlot Kidney Protein Explorer, 1 blot @PN=ADI-MKWB-61
product: Adult Mouse Tissues (10 ) ReadyBlot tissue Protein Explorer, 1 blot @PN=ADI-MTWB-71
product: Adult Rat Digestive Tract ReadyBlot Protein Explorer, 1 blot @PN=ADI-RDWB-51
product: Adult Rat ReadyBlot Kidney Protein Explorer, 1 blot @PN=ADI-RKWB-81
product: Adult Rat Tissues (10 ) ReadyBlot tissue Protein Explorer, 1 blot @PN=ADI-RTWB-91
product: Advanced Glycation End Products (Clone 9), DNA Aptamer, Biotinylated @PN=ADI-AD-157-B
product: Advanced Glycation End Products (Clone 9), DNA Aptamer, FITC labeled @PN=ADI-AD-157-F
product: Advanced Glycation End Products (Clone 9), DNA Aptamer, unlabeled @PN=ADI-AD-157-U
product: ADVASEP-7 @PN=70029
product: AEAETS (2-AMINOETHYL 2-AMINOETHANETHIOS @PN=91031
product: AEC Concentrate (3-amino-9-ethylcarbazole in stabilizing buffer), HRP-Chromogen @PN=LBU0019B
product: AEC HRP-Substrate Kit (2 Components), Result: Red Colour @PN=E103
product: AEC HRP-Substrate Kit (3 Components), Result: Red Colour @PN=E102
product: AEC Substrate Buffer @PN=LBU0020
product: AEE788 (NVP-AEE788), dual Inhibitor of Her2/Erbb2/EGFR (mol wt 440; >98%) @PN=ADI-SM-101100-5
product: AEE788 (NVP-AEE788), dual Inhibitor of Her2/Erbb2/EGFR (mol wt 440; >98%) @PN=ADI-SM-101100-25
product: Aeromonas Aminopeptidase:UC, Recombinant (Aeromonas Proteolytica), 29 kDa, Purity: >98% @PN=ENZ-275A
product: Aeromonas Aminopeptidase:UC, Recombinant (Aeromonas Proteolytica), 29 kDa, Purity: >98% @PN=ENZ-275B
product: Aeromonas Aminopeptidase:UC, Recombinant (Aeromonas Proteolytica), 29 kDa, Purity: >98% @PN=ENZ-275C
product: AF-1 (AA: Lys-Asn-Glu-Phe-Ile-Arg-Phe- NH2) (MW: 3576.06) @PN=ADI-SP-101854-5
product: AF-2, nematode (AA: Lys-His-Glu-Tyr-Leu-Arg-Phe- NH2) (MW: 991.17) @PN=ADI-SP-88345-5
product: Affinity column (Empty column for use with affinity supports, 0.5-1 ml complete with frit, top and bottom closures), 10 columns/pk @PN=ADI-800-300-C3
product: Affinity column (Empty column for use with affinity supports, 1-2 ml complete with frit, top and bottom closures), 10 columns/pk @PN=ADI-800-300-C1
product: Affinity column (Empty column for use with affinity supports, 5-15 ml complete with frit, top and bottom closures), 10 columns/pk @PN=ADI-800-300-C2
product: Aflatoxin M1 ELISA test kit (milk, milk powder and other dairy products), 96 tests @PN=ADI-DE-100330
product: Aflatoxins B1 ELISA test kit (Crops(corn, rice, peanut etc.), peanut butter, feed). 96 tests @PN=ADI-DE-100290
product: Aflibercept/Eylea ELISA Kit for human, 96 tests, quantitative @PN=ADI-200-360-AFL
product: Aflibercept/Eylea ELISA Kit for human, 96 tests, quantitative @PN=ADI-200-380-EBL
product: Aflibercept/Eylea identification/Counterfeit detection ELISA Kit, 24 tests @PN=ADI-200-370-ID24
product: Aflibercept/Eylea identification/Counterfeit detection ELISA Kit, 24 tests @PN=ADI-200-390-ID24
product: African Cassava Mosaic Virus:AP (ACMV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA73600-0500
product: African Cassava Mosaic Virus:AP (ACMV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA73600-1000
product: African Cassava Mosaic Virus:AP (ACMV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA73600-5000
product: African Cassava Mosaic Virus:AP (ACMV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA73600-0096
product: African Cassava Mosaic Virus:AP (ACMV), Polyclonal, Conjugated Antibody @PN=ECA73600-0500
product: African Cassava Mosaic Virus:AP (ACMV), Polyclonal, Conjugated Antibody @PN=ECA73600-1000
product: African Cassava Mosaic Virus:AP (ACMV), Polyclonal, Conjugated Antibody @PN=ECA73600-5000
product: African Cassava Mosaic Virus:UC (ACMV), Coating Antibody, Polyclonal @PN=CAB73600-0500
product: African Cassava Mosaic Virus:UC (ACMV), Coating Antibody, Polyclonal @PN=CAB73600-1000
product: African Cassava Mosaic Virus:UC (ACMV), Coating Antibody, Polyclonal @PN=CAB73600-5000
product: African clawed frog uroplakin 3A (UPK3A) control (non-phospho) peptide @PN=ADI-AB-23007-CP
product: African clawed frog uroplakin 3A (UPK3A) control (UPK3A- phosphor) peptide @PN=ADI-AB-23007-P
product: Agaricus Bisporus Lectin:Agarose bound, purified @PN=AL-1423
product: Agaricus Bisporus Lectin:Biotin @PN=B-1425
product: Agaricus Bisporus Lectin:FITC, purified @PN=FL-1421
product: Agaricus Bisporus Lectin:UC @PN=L-1420
product: Agarose Beads:UC @PN=AG-1000
product: Agarose:Biotin @PN=B-2011
product: AH1 peptide (gp70 H2-Ld-restricted epitope) (SPSYVYHQF, >95%) @PN=ADI-AH11-P-1
product: AH1 peptide (gp70 H2-Ld-restricted epitope) (SPSYVYHQF, >95%) @PN=ADI-AH11-P-10
product: Akt Specific Substrate Peptide, Akt/PKB (AA: Arg-Pro-Arg-Ala-Ala-Thr-Phe) (MW: 817.95) @PN=ADI-SP-81168-5
product: AKT/PKB/Rac - Protein Kinase Substrate (AA: Ala-Arg-Lys-Arg-Glu-Arg-Thr-Tyr-Ser-Phe-Gly-His-His-Ala) (MW: 1715.91) @PN=ADI-SP-86880-5
product: alamarBlue, proliferating cell measurement @PN=LBU0012A
product: alamarBlue® @PN=LBU012B
product: Alarelin Acetate @PN=ADI-PP-1020
product: Albumin (Human, Mouse, rat, bovine and others) @PN=ADI-800-200-BSA
product: Albumin (Human, Mouse, rat, bovine and others) Removal Kit @PN=ADI-800-205-BSA
product: Albumin (Human, Mouse, rat, bovine and others) Removal Kit @PN=ADI-800-225-BSA
product: Albumin-X, Albumin (multiple species) @PN=ADI-700-300-10
product: Albumin-X, Albumin (multiple species) Removal Kit @PN=ADI-700-1250-10
product: Albumin-X, Albumin (multiple species) removal kit (sufficient to remove 6-10 mg albumin or process ~200-300 ul serum; 10 mini-columns ~1.25 ml resin) @PN=ADI-LT-700MS-300ULX-10XC
product: Alcian Blue (pH 2.5) Stain Kit @PN=H-3501
product: ALCOHOL DEHYDROGENASE @PN=LIN0240-0504
product: Aldosterone Secretion Inhibiting Factor (1-35) (bovine) (MW: 39 @PN=ADI-SP-100519-1
product: Aleuria Aurantia Lectin (AAL) @PN=FL-1391
product: Aleuria Aurantia Lectin (AAL) coated plate for ELISA (sugar specificity: Fucose), 5 plates/pk @PN=ADI-AAL16-CP
product: Aleuria Aurantia Lectin:Agarose bound:Agarose bound (AAL) @PN=AL-1393
product: Aleuria Aurantia Lectin:AP (AAL) @PN=MB-4100
product: Aleuria Aurantia Lectin:Biotin (AAL) @PN=B-1395
product: Aleuria Aurantia Lectin:UC (AAL) @PN=L-1390
product: Alexa Fluor® 488 Protein Labeling Kit, @PN=A10235
product: Alexa Fluor® 568 Protein Labeling Kit @PN=A10238
product: Alfalfa Mosaic Virus:AP (AMV), Conjugated Antibody @PN=ECA87601-0500
product: Alfalfa Mosaic Virus:AP (AMV), Conjugated Antibody @PN=ECA87601-1000
product: Alfalfa Mosaic Virus:AP (AMV), Monoclonal, Conjugated Antibody @PN=ECA87601-5000
product: Alfalfa Mosaic Virus:AP (AMV), Poly/Mono, PathoScreen DAS ELISA-Kit @PN=PSA87601-0096
product: Alfalfa Mosaic Virus:AP (AMV), Poly/Mono, PathoScreen DAS ELISA-Kit @PN=PSA87601-0288
product: Alfalfa Mosaic Virus:AP (AMV), Poly/Mono, PathoScreen DAS ELISA-Kit @PN=PSA87601-0480
product: Alfalfa Mosaic Virus:AP (AMV), Poly/Mono, Reagent Set TAS ELISA, contains: Coating+Conjugated Ab @PN=SRA87601-0500
product: Alfalfa Mosaic Virus:AP (AMV), Poly/Mono, Reagent Set TAS ELISA, contains: Coating+Conjugated Ab @PN=SRA87601-1000
product: Alfalfa Mosaic Virus:AP (AMV), Poly/Mono, Reagent Set TAS ELISA, contains: Coating+Conjugated Ab @PN=SRA87601-5000
product: Alfalfa Mosaic Virus:AP (AMV), Poly/Mono, Reagent Set TAS ELISA, contains: Coating+Conjugated Ab @PN=SRA87601-0096
product: Alfalfa Mosaic Virus:UC (AMV), Negative Control @PN=LNC87601
product: Alfalfa Mosaic Virus:UC (AMV), Polyclonal, Coating Antibody @PN=CAB87601-0500
product: Alfalfa Mosaic Virus:UC (AMV), Polyclonal, Coating Antibody @PN=CAB87601-1000
product: Alfalfa Mosaic Virus:UC (AMV), Polyclonal, Coating Antibody @PN=CAB87601-5000
product: Alfalfa Mosaic Virus:UC (AMV), Positive Control @PN=LPC87601
product: Alhydrogel® 2%, Vaccine adjuvant, FDA Approved @PN=ADI-AV-1010-100
product: Alhydrogel® 2%, Vaccine adjuvant, FDA Approved @PN=ADI-AV-1010-50
product: ALKALINE PHOSPHATASE @PN=LIN0300-1706
product: ALKALINE PHOSPHATASE @PN=LIN0300-2304
product: Alkaline Phosphatase @PN=ADI-RP-1468
product: Alkaline Phosphatase (1000 Glycine U/mg protein), Calf Intestine @PN=ADI-ALP-04
product: Alkaline Phosphatase (2600 DEA U/mg protein), Calf Intestine @PN=ADI-ALP-10
product: Alkaline Phosphatase (700 Glycine U/mg protein), Calf Intestine @PN=ADI-ALP-03
product: Alkaline phosphatase (AP), calf intestine, Conjugation grade (3000-6000 u/mg) @PN=ADI-ALP15-N-1
product: Alkaline phosphatase (AP), calf intestine, Conjugation grade (3000-6000 u/mg) @PN=ADI-ALP15-N-10
product: Alkaline phosphatase (AP), calf intestine, Mol Biol grade (3000-6000 u/mg) (free Free of endonuclease, exonuclease and RNase activities) @PN=ADI-ALP16-N-1
product: Alkaline phosphatase (AP), calf intestine, Mol Biol grade (3000-6000 u/mg) (free Free of endonuclease, exonuclease and RNase activities) @PN=ADI-ALP16-N-10
product: Alkaline Phosphatase (Calf, AP) Enzyme, purified EIA grade @PN=ADI-ALP15-N-5
product: Alkaline Phosphatase Goat anti-mouse IgG (H+L), 1 mg/mL @PN=20464-100uL
product: Alkaline Phosphatase:Biotin @PN=B-2005
product: All Species c-myc #1:UC (Fusion Tag), Control Peptide @PN=ADI-MYC11-P
product: All Species Hemeagglutinin-Fusion Epitope #1:UC (HA-Tag), Control Peptide @PN=ADI-HA11-P
product: Allatostatin I (free acid) (AA: Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu) (MW: 1335.5) @PN=ADI-SP-100832-5
product: Allatostatin II (AA: Gly-Asp-Gly-Arg-Leu-Tyr-Ala-Phe-Gly-Leu-NH2) (MW: 1067.2) @PN=ADI-SP-100500-5
product: Allatostatin III (AA: Gly-Gly-Ser-Leu-Tyr-Ser-Phe-Gly-Leu-NH2) (MW: 899.02) @PN=ADI-SP-100501-5
product: Allatostatin IV (AA: Asp-Arg-Leu-Tyr-Ser-Phe-Gly-Leu-NH2) (MW: 969.1) @PN=ADI-SP-100502-5
product: Allatostatin VI (AA: Tyr-Pro-Gln-Glu-His-Arg-Phe-Ser-Phe-Gly-Leu-NH2) (MW: 1379.5) @PN=ADI-SP-100833-5
product: Allatostatin VII (AA: Asp-Gly-Arg-Met-Tyr-Ser-Phe-Gly-Leu-NH2) (MW: 1044.2) @PN=ADI-SP-100834-5
product: Allatostatin [H-Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-tyr-Gly-Phe-Gly-Leu-NH2; MW: 1335.54] @PN=ADI-SP-55137-1
product: Allatotropin, Mas - AT (AA:Gly-Phe-Lys-Asn-Val-Glu-Met-Met-Thr-Ala-Arg-Gly-Phe-NH2 (Disulfide bridge:Cys2-Cys7) (MW: 1486.8) @PN=ADI-SP-100835-1
product: Alloferon 1 (AA: His-Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly) (MW: 1265.3) @PN=ADI-SP-77584-5
product: Alloferon 2 (AA: Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly) (MW: 1128.2) @PN=ADI-SP-100504-5
product: Allophycocyanin F(ab')2 fragment of goat anti-mouse IgG(H+L), 0.5 mg/mL @PN=20414-100uL
product: Allophycocyanin F(ab')2 fragment of goat anti-mouse IgG(H+L), 0.5 mg/mL @PN=20414-500uL
product: Allophycocyanin F(ab')2 fragment of goat anti-rabbit IgG(H+L), 0.5 mg/mL @PN=20415-100uL
product: Allophycocyanin F(ab')2 fragment of goat anti-rabbit IgG(H+L), 0.5 mg/mL @PN=20415-500uL
product: Allophycocyanin goat anti-mouse IgG(H+L), 0.5 mg/mL @PN=20411-100uL
product: Allophycocyanin goat anti-mouse IgG(H+L), 0.5 mg/mL @PN=20411-500uL
product: Allophycocyanin goat anti-rabbit IgG(H+L), 0.5 mg/mL @PN=20412-100uL
product: Allophycocyanin goat anti-rabbit IgG(H+L), 0.5 mg/mL @PN=20412-500uL
product: Allophycocyanin goat anti-rat IgG(H+L), highly cross-adsorbed, 0.5 mg/mL @PN=20413-100uL
product: Allophycocyanin goat anti-rat IgG(H+L), highly cross-adsorbed, 0.5 mg/mL @PN=20413-500uL
product: Alpha 1 Acid Glycoprotein (A1-AGP), bovine @PN=ADI-A1AG20-N
product: Alpha 1 Acid Glycoprotein (A1-AGP), Human Plasma @PN=ADI-A1AG15-N
product: ALPHA 1 ANTITRYPSIN @PN=LIN0640-5604
product: ALPHA 1 MICROGLOBULIN @PN=LIN6220-1004
product: Alpha 1-Antichymotrypsin, Human Plasma @PN=ADI-A1CT15-N-100
product: Alpha 1-Antitrypsin, Human Plasma @PN=ADI-A1AT15-N
product: Alpha 1-Antitrypsin, Human protein control for WB @PN=ADI-A1AT11-C
product: ALPHA 2 MACROGLOBULIN @PN=LIN5850-2004
product: Alpha 2-Antiplasmin, Human Plasma @PN=ADI-A2AP15-100
product: Alpha 2-HS Glycoprotein, Human Plasma @PN=ADI-A2HG15-N
product: Alpha 2-Macroglobulin (A2M), Human Plasma @PN=ADI-A2MG15-N
product: Alpha 2-Macroglobulin (A2M), Human protein control for WB @PN=ADI-A2MG11-C
product: Alpha Actinin @PN=pro-518A
product: Alpha Actinin @PN=pro-518B
product: Alpha Actinin @PN=pro-518C
product: ALPHA FETOPROTEIN @PN=LPH152
product: ALPHA MELANOCYTE STIMULATING HORMONE @PN=LIN6045-0504
product: Alpha V Beta 5 Integrin, Peptide Aptamer, Biotinylated @PN=ADI-AP-301-B
product: Alpha V Beta 5 Integrin, Peptide Aptamer, FITC labelled @PN=ADI-AP-301-F
product: Alpha V Beta 5 Integrin, Peptide Aptamer, Unlabelled @PN=ADI-AP-301-U
product: Alpha-1-Acid Glycoprotein Protein, Dog, purified @PN=ADI-A1AG17-N-25
product: Alpha-1-Acid Glycoprotein Protein, Rat, purified @PN=ADI-A1AG19-N-25
product: Alpha-1-Acid Glycoprotein Protein, Rat, purified control for western @PN=ADI-A1AG19-C
product: Alpha-1-Acid Glycoprotein Protein, Cat, purified @PN=ADI-A1AG16-N-25
product: Alpha-1-Acid Glycoprotein Protein, Dog, control for western @PN=ADI-A1AG17-C
product: Alpha-1-Acid Glycoprotein Protein, Mouse, control for western @PN=ADI-A1AG18-C
product: Alpha-1-Acid Glycoprotein Protein, Mouse, Purified @PN=ADI-A1AG18-N-25
product: ALPHA-BUNGAROTOXIN @PN=00010-1
product: ALPHA-BUNGAROTOXIN CF594 @PN=00007
product: alpha-bungarotoxin, CF405S @PN=00002
product: alpha-bungarotoxin, CF488A @PN=00005
product: alpha-bungarotoxin, CF543 @PN=00026
product: alpha-bungarotoxin, CF555 @PN=00018
product: alpha-bungarotoxin, CF568 @PN=00006
product: alpha-bungarotoxin, CF633 @PN=00009
product: alpha-bungarotoxin, CF640R @PN=00004
product: alpha-bungarotoxin, CF680R @PN=00003
product: Alpha-Methyl Glucoside:UC (Sugars), Lyophilised @PN=S-9006
product: Alpha-Methyl Mannoside:UC (Sugars), Lyophilized @PN=S-9005
product: Alpha-V Beta-3 (Clone 17.16), RNA Aptamer, unlabeled @PN=ADI-AR-287-U
product: Alstroemeria Mosaic Virus:AP (AIMV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA39000-0500
product: Alstroemeria Mosaic Virus:AP (AIMV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA39000-1000
product: Alstroemeria Mosaic Virus:AP (AIMV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA39000-5000
product: Alstroemeria Mosaic Virus:AP (AIMV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA39000-0096
product: Alstroemeria Mosaic Virus:AP (AIMV), Polyclonal, Conjugated Antibody @PN=ECA39000-0500
product: Alstroemeria Mosaic Virus:AP (AIMV), Polyclonal, Conjugated Antibody @PN=ECA39000-1000
product: Alstroemeria Mosaic Virus:AP (AIMV), Polyclonal, Conjugated Antibody @PN=ECA39000-5000
product: Alstroemeria Mosaic Virus:UC (AIMV), Polyclonal, Coating Antibody @PN=CAB39000-0500
product: Alstroemeria Mosaic Virus:UC (AIMV), Polyclonal, Coating Antibody @PN=CAB39000-1000
product: Alstroemeria Mosaic Virus:UC (AIMV), Polyclonal, Coating Antibody @PN=CAB39000-5000
product: Alstroemeria mosaic virus:UC (AlMV), Positive Control @PN=LPC39000
product: Alstroemeria mosaic virus:UC (AlMV)Negative Control @PN=LNC39000
product: Alternanthera mosaic virus /Papaya Mosaic Virus:AP (AltMV/PapMV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA53400-0096
product: Alternanthera mosaic virus /Papaya Mosaic Virus:AP (AltMV/PapMV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA53400-0500
product: Alternanthera mosaic virus /Papaya Mosaic Virus:AP (AltMV/PapMV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA53400-1000
product: Alternanthera mosaic virus /Papaya Mosaic Virus:AP (AltMV/PapMV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA53400-5000
product: Alternanthera mosaic virus /Papaya Mosaic Virus:AP (AltMV/PapMV), Polyclonal, Conjugated Antibody @PN=ECA53400-5000
product: Alternanthera mosaic virus /Papaya Mosaic Virus:AP (AltMV/PapMV), Polyclonal, Conjugated Antibody @PN=ECA53400-0500
product: Alternanthera mosaic virus /Papaya Mosaic Virus:AP (AltMV/PapMV), Polyclonal, Conjugated Antibody @PN=ECA53400-1000
product: Alternanthera mosaic virus /Papaya Mosaic Virus:UC (AltMV/PapMV), Positive Control @PN=LPC53400
product: Alternanthera mosaic virus /Papaya Mosaic Virus:UC (AltMV/PapMV)Negative Control @PN=LNC53400
product: Alternate Syntide (AA: Pro-Leu-Ser-Arg-Thr-Leu-Ser-Val-Ser-Ser-Leu-Pro-Gly-Leu- NH2) (MW: 1425.70) @PN=ADI-SP-86720-1
product: Alum Gel Combo, Trial Pak-1 (Contains 10 ml each of Alhydrogel, Adjuphos, and Calcium Phosphate gels) @PN=ADI-AV-1000-PK-1
product: Alytesin [pGlu-Gly-Arg-Leu-Gly-Thr-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MW: 1535.8] @PN=ADI-SP-55151-1
product: AM1-43 @PN=70024
product: AM1-44 @PN=70038
product: AM2-10 @PN=70036
product: AM3-25 @PN=70051
product: AM4-64 @PN=70025
product: AM4-65 @PN=70039
product: AM4-67 @PN=70050
product: Amantadine ELISA kit, 96 tests @PN=ADI-DE-100600
product: Amaranthus Caudatus Lectin:Biotin (ACL, ACA) @PN=B-1255
product: Amaranthus Caudatus Lectin:FITC (ACL, ACA) @PN=FL-1251
product: Amaranthus Caudatus Lectin:UC (ACL, ACA) @PN=L-1250
product: AMCA-X, SE @PN=90077
product: American Plum Line Pattern Virus:AP (APLPV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA32000-0096
product: American Plum Line Pattern Virus:AP (APLPV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA32000-0500
product: American Plum Line Pattern Virus:AP (APLPV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA32000-1000
product: American Plum Line Pattern Virus:AP (APLPV), Poly/Poly, Reagent Set DAS ELISA, contains: Coating+Conjugated Ab @PN=SRA32000-5000
product: American Plum Line Pattern Virus:AP (APLPV), Polyclonal, Conjugated Antibody @PN=ECA32000-0500
product: American Plum Line Pattern Virus:AP (APLPV), Polyclonal, Conjugated Antibody @PN=ECA32000-1000
product: American Plum Line Pattern Virus:AP (APLPV), Polyclonal, Conjugated Antibody @PN=ECA32000-5000
product: American Plum Line Pattern Virus:UC (APLPV), Negative Control @PN=LNC32000
product: American Plum Line Pattern Virus:UC (APLPV), Polyclonal, Coating Antibody @PN=CAB32000-0500
product: American Plum Line Pattern Virus:UC (APLPV), Polyclonal, Coating Antibody @PN=CAB32000-1000
product: American Plum Line Pattern Virus:UC (APLPV), Polyclonal, Coating Antibody @PN=CAB32000-5000
product: American Plum Line Pattern Virus:UC (APLPV), Positive Control @PN=LPC32000
product: Amikacin, Sulfate (>98% pure) @PN=ADI-ABT-010-10
product: Amikacin, Sulfate (>98% pure), antibacterial @PN=ADI-ABT-010-01
product: Amino Terminal Fragment (AA: Met-Lys-Asp-Asn-Phe-Ser-Phe-Ala-Ala-Thr-Ser-Arg-Asn-Ile-Thr-Ser-Ser) (MW: 1877.08) @PN=ADI-SP-87929-1
product: AMINOOXY-5(6)-FAM @PN=90103
product: AMINOOXY-5(6)-ROX @PN=90104
product: AMINOOXY-5(6)-TAMRA @PN=90105
product: AMINOOXY-BIOTIN @PN=90113
product: Aminopeptidase N, Peptide Aptamer, Biotinylated @PN=ADI-AP-302-B
product: Aminopeptidase N, Peptide Aptamer, FITC labelledIntr @PN=ADI-AP-302-F
product: Aminopeptidase N, Peptide Aptamer, Unlabelled @PN=ADI-AP-302-U
product: Amoxicillin (>98% pure) @PN=ADI-ABT-020-05
product: Amoxicillin (>98% pure) @PN=ADI-ABT-020-50
product: Amphetamine-BSA conjugate for ELISA/Western @PN=ADI-AMPT15-N-500
product: Amphotericin B (>98% pure) @PN=ADI-ABT-490-01
product: Amphotericin B (>98% pure) @PN=ADI-ABT-490-10
product: Ampicillin (>98% pure) @PN=ADI-ABT-670-25
product: Ampicillin (>98% pure) @PN=ADI-ABT-670-100
product: Ampicillin ELISA kit, (For Pork/Liver, Chicken, Duck, Shrimp, Fish, Honey, Milk), 96 tests @PN=ADI-DE-100140
product: Ampicillin Trihydrate, Sodium (>98% pure) @PN=ADI-ABT-030-25
product: Ampicillin Trihydrate, Sodium (>98% pure) @PN=ADI-ABT-030-05
product: Amylase Test (colorimteric) 100 tests, Quantitative @PN=ADI-1305
product: Amylin (1-13) (human) (AA: Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala (Disulfide bridge:Cys2-Cys7)) (MW: 1378.60) @PN=ADI-SP-89376-1
product: Amylin (20-29) (human) (AA: Ser-Asn-Asn-Phe-Gly-Ala-Ile-Leu-Ser-Ser) (MW: 1009.09) @PN=ADI-SP-89379-5
product: Amylin (8-37), human (MW: 3184.5) @PN=ADI-SP-55237-1
product: Amylin(8-37), Rat [H-Ala-Thr-Gln-Arg-Ley-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Ley-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2; MW: 3200.63] @PN=ADI-SP-55284-1
product: Amylin(IAPP)(Feline) [H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Ley-Ala-Asn-Phe-Leu-Ile-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Ala-Ile-Leu-Ser-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2; MW: 3910.45] @PN=ADI-SP-55201-1
product: Amylin, Human [H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Ley-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Ala-Ile-Leu-Ser-Ser-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-OH; MW: 3184.5] @PN=ADI-SP-55204-1
product: Amylin,human (MW: 3903.4) @PN=ADI-SP-52219-1
product: Amyloid (1-40), Rat [H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Gly-Val-Arg-His-Gin-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH; MW: 4233.81] @PN=ADI-SP-53770-1
product: Amyloid (1-42), Human @PN=ADI-SP-52487-1
product: Amyloid (25-35) peptide [H-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Oh; MW: 1060.3] @PN=ADI-SP-51106-1
product: Amyloid Bri Protein (1-23)) (MW: 2628.00) @PN=ADI-SP-83872-05
product: Amyloid Bri Protein (1-34) (reduced) (AA: Pyr-Ala-Ser-Asn-Cys-Phe-Ala-Ile-Arg-His-Phe-Glu-Asn-Lys-Phe-Ala-Val-Glu-Thr-Leu-Ile-Cys-Ser-Arg-Thr-Val-Lys-Lys-Asn-Ile-Ile-Glu-Glu-Asn) (MW: 3937.55) @PN=ADI-SP-89285-05
product: Amyloid Bri Protein (1-34)) (MW: 3935.55) @PN=ADI-SP-89286-05
product: Amyloid Bri Protein Precursor277 (89-106) (AA: Cys-Gly-Ile-Lys-Tyr-Ile-Lys-Asp-Asp-Val-Ile-Leu-Asn-Glu-Pro-Ser-Ala-Asp) (MW: 1993.27) @PN=ADI-SP-89287-1
product: Amyloid Dan Protein (1-34) (reduced) (AA: Pyr-Ala-Ser-Asn-Cys-Phe-Ala-Ile-Arg-His-Phe-Glu-Asn-Lys-Phe-Ala-Val-Glu-Thr-Leu-Ile-Cys-Phe-Asn-Leu-Phe-Leu-Asn-Ser-Gln-Glu-Lys-His-Tyr) (MW: 4046.63) @PN=ADI-SP-89290-1
product: Amyloid Dan Protein (1-34)) (MW: 4044.63) @PN=ADI-SP-89288-1
product: Amyloid P Component (33-38) amide (AA: Phe-Thr-Leu-Cys-Phe-Arg-NH2) (MW: 784.98) @PN=ADI-SP-89284-5
product: Amyloid Peptide BetaA4(1- 40) (B55) , RNA Aptamer, unlabeled @PN=ADI-AR-204-U
product: Amyloid Peptide(1-42), Rat @PN=ADI-SP-53771-1
product: Amyloid ß-Protein (1-43) (MW: 4615.24) @PN=ADI-SP-89298-1
product: Amyloid ß-Protein (20-29) (AA: Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly) (MW: 1023.08) @PN=ADI-SP-89304-5
product: Amyloid ß-Protein (25-35) amide (AA: Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-NH2) (MW: 1059.31) @PN=ADI-SP-89305-5
product: Amyloid ß-Protein (29-40) (AA: Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val) (MW: 1085.38) @PN=ADI-SP-62497-1
product: Amyloid ß-Protein (33-42) (AA: Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala) (MW: 915.17) @PN=ADI-SP-80702-5
product: Amyloid ß-Protein (42-1) (MW: 4514.14) @PN=ADI-SP-53819-1
product: Amyloid ß-Protein (6-20) (AA: His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe) (MW: 1843.05) @PN=ADI-SP-71897-1
product: Amyloid ß/A4 Protein Precursor770 (667-676) (AA: Ser-Glu-Val-Lys-Met-Asp-Ala-Glu-Phe-Arg) (MW: 1211.37) @PN=ADI-SP-89314-5
product: Amyloid ß/A4 Protein Precursor770 (740-770) (AA: Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn) (MW: 3717.14) @PN=ADI-SP-72257-1
product: Amyloid(1-40), UltraPure, TFA @PN=ADI-SP-51516
product: Anantin (MW: 1871) @PN=ADI-SP-102059-1
product: Andean Potato Latent Virus:AP (APLV), Poly/Poly, PathoScreen DAS ELISA-Kit @PN=PSA40200-0096
product: Andean Potato Latent Virus:AP (APLV), Poly/Poly, PathoScreen DAS ELISA-Kit @PN=PSA40200-0288
product: Andean Potato Latent Virus:AP (APLV), Poly/Poly, PathoScreen DAS ELISA-Kit @PN=PSA40200-0480
product: Andean Potato Latent Virus:AP (APLV), Poly/Poly, Reagent Set DAS ELISA @PN=SRA40200-0500
product: Andean Potato Latent Virus:AP (APLV), Poly/Poly, Reagent Set DAS ELISA @PN=SRA40200-1000
product: Andean Potato Latent Virus:AP (APLV), Poly/Poly, Reagent Set DAS ELISA @PN=SRA40200-5000
product: Andean Potato Latent Virus:AP (APLV), Poly/Poly, Reagent Set DAS ELISA @PN=SRA40200-0096
product: Andean Potato Latent Virus:AP (APLV), Polyclonal, Conjugated Antibody @PN=ECA40200-0500
product: Andean Potato Latent Virus:AP (APLV), Polyclonal, Conjugated Antibody @PN=ECA40200-1000
product: Andean Potato Latent Virus:AP (APLV), Polyclonal, Conjugated Antibody @PN=ECA40200-5000
product: Andean Potato Latent Virus:UC (APLV), Negative Control @PN=LNC40200
product: Andean Potato Latent Virus:UC (APLV), Polyclonal, Coating Antibody @PN=CAB40200-0500
product: Andean Potato Latent Virus:UC (APLV), Polyclonal, Coating Antibody @PN=CAB40200-1000
product: Andean Potato Latent Virus:UC (APLV), Polyclonal, Coating Antibody @PN=CAB40200-5000
product: Angelonia flower break virus:AP (AnFBV), Polyclonal, Conjugated Antibody @PN=ECA36600-0500
product: Angelonia flower break virus:AP (AnFBV), Polyclonal, Conjugated Antibody @PN=ECA36600-1000
product: Angelonia flower break virus:AP (AnFBV), Polyclonal, Conjugated Antibody @PN=ECA36600-5000
product: Angelonia flower break virus:UC (AnFBV), Control Negative @PN=LNC36600
product: Angelonia flower break virus:UC (AnFBV), Control Positive @PN=LPC36600
product: Angelonia flower break virus:UC (AnFBV), Polyclonal, Coating Antibody @PN=CAB36600-0500
product: Angelonia flower break virus:UC (AnFBV), Polyclonal, Coating Antibody @PN=CAB36600-1000
product: Angelonia flower break virus:UC (AnFBV), Polyclonal, Coating Antibody @PN=CAB36600-5000
product: Angiogenin (108-122) (AA: Glu-Asn-Gly-Leu-Pro-Val-His-Leu-Asp-Gln-Ser-Ile-Phe-Arg-Arg) (MW: 1781.02) @PN=ADI-SP-89318-1
product: Angiogenin (108-123) (AA: Glu-Asn-Gly-Leu-Pro-Val-His-Leu-Asp-Gln-Ser-Ile-Phe-Arg-Arg-Pro) (MW: 1878.14) @PN=ADI-SP-89319-1
product: Angiontensin III, Human [H-Arg-Val-Tyr-Ile-His-Pro-Phe-OH; MW: 931.1] @PN=ADI-SP-52222-5
product: Angiotensin @PN=enz-283A
product: Angiotensin @PN=enz-283B
product: Angiotensin @PN=enz-283C
product: Angiotensin @PN=ADI-RP-1465
product: Angiotensin (1-5) (AA: Asp-Arg-Val-Tyr-Ile) (MW: 664.77) @PN=ADI-SP-87930-5
product: Angiotensin (1-9) (AA: Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His) (MW: 1183.35) @PN=ADI-SP-76166-5
product: Angiotensin A (AA: Ala-Arg-Val-Tyr-Ile-His-Pro-Phe) (MW: 1183.34) @PN=ADI-SP-100365-5
product: Angiotensin Acetate (Asp-Arg-Val-Tyr-Val-His-Pro-Phe (MW: 1031.2)) @PN=ADI-PP-1030
product: Angiotensin Converting Enzyme Inhibitor [H-pGlu-Trp-Pro-Arg-Pro-Gln-Ile-Pro-Pro-Oh; MW: 1102.29] @PN=ADI-SP-55333-5
product: Angiotensin I [Des-Asp1-](Human) [H-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH; MW: 1181.42] @PN=ADI-SP-55331-5
product: Angiotensin I, Human [H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH; MW: 1296.5] @PN=ADI-SP-52220-5
product: Angiotensin I-Converting Enzyme Substrate (AA: Bz-Phe-Ala-Pro) (MW: 437.49) @PN=ADI-SP-89341-5
product: Angiotensin I/II (1-6) (AA: Asp-Arg-Val-Tyr-Ile-His) (MW: 801.91) @PN=ADI-SP-89330-5
product: Angiotensin I/II (3-7) (AA: Val-Tyr-Ile-His-Pro) (MW: 627.75) @PN=ADI-SP-65061-5
product: Angiotensin I/II (5-8) (AA: Ile-His-Pro-Phe) (MW: 512.61) @PN=ADI-SP-88316-5
product: Angiotensin II (1-4), Human [H-Asp-Arg-Val-Tyr-OH; MW: 551.6] @PN=ADI-SP-55177-5
product: Angiotensin II (4-8), Human [H-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-OH; MW: 675.79] @PN=ADI-SP-55193-5
product: Angiotensin II Acetate @PN=ADI-PP-1040
product: Angiotensin II Antipeptide (AA: Glu-Gly-Val-Tyr-Val-His-Pro-Val) (MW: 899.02) @PN=ADI-SP-88315-5
product: Angiotensin II Substrate (AA: Asp-Arg-Val-Tyr(PO3H2)-Ile-His-Pro-Phe) (MW: 1126.20) @PN=ADI-SP-88314-5
product: Angiotensin II type 1 receptor (181 - 187), AT1, ATE. (AA: Ala-Phe-His-Tyr-Glu-Ser-Gln) (MW: 880.92) @PN=ADI-SP-88313-5
product: Angiotensin II [Des-Asp1-](Human) [Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH; MW: 1046.19] @PN=ADI-SP-51480-5
product: Angiotensin II(3-8), Human [H-Val-Tyr-Ile-His-Pro-Phe-OH; MW: 774.93] @PN=ADI-SP-55200-5
product: Angiotensin II-BiotinSynthetic peptide @PN=BDI1035AG.3
product: Angiotensin II:Biotin Synthetic peptide @PN=AB-1001
product: Angiotensin II[Sar1 Ile8] [H-Sar-Arg-Val-Tyr-Ile-His-Pro-Ile-Oh; MW: 968.1] @PN=ADI-SP-55317-5
product: ANGIOTENSIN IV @PN=LIN0560-1529
product: Angiotensin, Canine, Rat [H-Asp-Arg-Val-Tyr-Ile-His-Pro-OH; MW: 899.03] @PN=ADI-SP-55246-5
product: Angiotensinogen (1- 13) (AA: Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His) (MW: 1645.9) @PN=ADI-SP-101676-5
product: Angiotensinogen (1-14) ,Rat (AA: Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Tyr-Tyr-Ser) (MW: 1823.1) @PN=ADI-SP-101679-5
product: Angiotensinogen (1-14) [H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Asn-OH; MW: 1760.05] @PN=ADI-SP-55138-1
product: Angiotensinogen (1-14), Porcine (AA: Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser) (MW: 1759.1) @PN=ADI-SP-101678-5
product: Angiotensinogen, Human Plasma @PN=ADI-ATN15-N-100
product: Angullia Angullia Lectin:Biotin (AAA) @PN=LEA4909
product: Aniline, 10X in acetate buffer @PN=91057
product: Animal Free Blocker (5x) @PN=SP-5030
product: Annexin 1 (ANXA - 1; Ac 2 - 12) (AA:Ac-Ala-Met-Val-Ser-Glu-Phe-Leu-Lys-Gln-Ala-Trp) (MW: 1351.60) @PN=ADI-SP-88317-5
product: ANNEXIN A9 @PN=LPH231
product: ANNEXIN I @PN=LPH226
product: ANNEXIN II @PN=LPH227
product: ANNEXIN III @PN=LPH228
product: ANNEXIN V @PN=LPH186
product: ANNEXIN V @PN=LPH229
product: ANNEXIN V CF488 CONJUGATE @PN=29005
product: ANNEXIN V CF568 CONJUGATE @PN=29010
product: ANNEXIN V CF594 CONJUGATE @PN=29011
product: ANNEXIN V CF633 CONJUGATE @PN=29008
product: ANNEXIN V CF680 CONJUGATE @PN=29007
product: ANNEXIN V CF750 CONJUGATE @PN=29006
product: ANNEXIN V FITC CONJUGATE @PN=29001
product: ANNEXIN V SULFORHODAMINE 101 CONJUGATE @PN=29002
product: ANNEXIN V BINDING BUFFER 5X @PN=99902
product: ANNEXIN V KIT @PN=LANNEX200APC
product: ANNEXIN V KIT @PN=LANNEX200PE
product: ANNEXIN V KIT @PN=LANNEX20B
product: ANNEXIN V KIT @PN=LANNEX20F
product: ANNEXIN V KIT @PN=LANNEX50APC
product: ANNEXIN V KIT @PN=LANNEX50PE
product: Annexin V, Allophycocyanin crosslinked conjugate (100 assays) @PN=29057-500uL
product: Annexin V, Allophycocyanin crosslinked conjugate (20 assays) @PN=29057-100uL
product: Annexin V, Biotin conjugate @PN=29013
product: ANNEXIN V, CF 555 CONJUGATE @PN=29004
product: ANNEXIN V, CF 647 CONJUGATE @PN=29003
product: Annexin V, CF350 conjugate @PN=29012
product: Annexin V, CF405M conjugate @PN=29009
product: Annexin V, CF640R conjugate @PN=29014
product: Annexin V, CF660R conjugate @PN=29069
product: Annexin V, CF680R conjugate @PN=29070
product: Annexin V, CF770 @PN=29046
product: Annexin V, CF790 @PN=29047
product: Annexin V, R-phycoerythrin conjugate (100 assays) @PN=29045-500uL
product: Annexin V, R-phycoerythrin conjugate (20 assays) @PN=29045-100uL
product: Annexin V:Alexa488 Recombinant protein conjugate @PN=AB-1002
product: Annexin V:Alexa488 Recombinant protein conjugate @PN=AB-1003
product: Annexin V:Biotin @PN=LAN0100B
product: Annexin V:Biotin @PN=LAN0300B
product: Annexin V:FITC @PN=LAN0300F
product: Annexin-V Kit:FITC for Detecting Apoptosis by Flow Cytometry @PN=KAK0100F
product: Anorexigenic Peptide [pGlu-His-Gly-OH; MW: 323.4] @PN=ADI-SP-55353-1
product: ANP (1-11), Rat [H-Ser-Ley-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-OH; MW: 1224.4] @PN=ADI-SP-55370-1
product: ANP(1-30), Frog peptide [H-Ala-Pro-Arg-Ser-Met-Arg-Arg-Ser-Ser-Asp-Cys-Phe-Gly-Ser-Arg-Ile-Asp-Asp-Ile-Gly-Ala-Gln-Ser-Gly-Met-Gly-Cys-Fly-Arg-Phe-OH(Cys11-Cys27); MW: 3260.73] @PN=ADI-SP-55423-1
product: Ant-Human Apolipoprotein B IgG, aff pure @PN=ADI-APOB21-A
product: Antagonist G [H-Ard-D-Trp-N-Me-Phe-D-Trp-Ley-Met-NH2; MW: 951.2] @PN=ADI-SP-55256-1
product: Antho-Rfamide (AA: Pyr-Gly-Arg-Phe-NH2) (MW: 488.57) @PN=ADI-SP-88346-5
product: Antho-Rwamide I (AA: Pyr -Ser-Leu-Arg-Trp-NH2) (MW: 670.79) @PN=ADI-SP-88347-5
product: Antho-Rwamide II (AA: Pyr -Gly-Leu-Arg-Trp-NH2) (MW: 640.79) @PN=ADI-SP-88348-5
product: Anthrax Edema Factor:HRP (EF), Protein ELISA Kit, Quantitative, Assay, 96 tests @PN=ADI-800-130-EF
product: Anthrax Lethal Factor (LF) Protein IgG antiserum negative control @PN=ADI-800-120-02P
product: Anthrax Lethal Factor (LF) Protein ELISA Kit, 96 tests @PN=ADI-800-120-LF
product: Anthrax protective antigen, RNA aptamer @PN=ADI-AR-318-U
product: Anthrax Protective Antigen-83 (PA83), Quantitative, Protein ELISA 96-well 8 Strip, Assay, 96 tests @PN=ADI-800-100-P83
product: Anthrax Protective Antigen:UC Protein, Recombinant (B. anthracis), 63.000 kDa @PN=ADI-PA63-R
product: Anthrax Protective Antigen:UC Protein, Recombinant (B. anthracis), 83.000 kDa, Purity 90-95% @PN=ADI-PA83-R
product: Anti Protein A IgG, aff pure @PN=ADI-PRTA11-A
product: anti- KLH IgG (total), ELISA Kit, 96 tests, Quantitative, Mouse, Assay @PN=ADI-700-130-KLM
product: Anti-(DRAAGQPAG)3 peptide (repeat-sequence peptide of the P. vivax circumsporozoite protein, CSP) IgG, aff pure @PN=ADI-DRAA31-A
product: Anti-(NANP)5 peptide (25-aa, repeat-sequence peptide of the P. falciparum circumsporozoite protein), CSP IgG, aff pure @PN=ADI-NANP51-A
product: Anti-(NVDP)4 peptide (minor repeat-sequence peptide of the P. falciparum circumsporozoite protein, CSP) IgG, aff pure @PN=ADI-NVDP41-A
product: Anti-(PPPPNAAND)3 peptide (repeat-sequence peptide of the P. berghei circumsporozoite protein, CSP) IgG, aff pure @PN=ADI-PPPP321-A
product: Anti-(Swine/Porcine) IgA aff pure, unlabeled @PN=ADI-90445
product: Anti-(Swine/Porcine) IgA-Biotin Conjugate @PN=ADI-90447
product: Anti-(Swine/Porcine) IgA-HRP Conjugate @PN=ADI-90446
product: Anti-(Swine/Porcine) IgG (Fc), aff pure, unconjugated @PN=ADI-90419
product: Anti-(Swine/Porcine) IgG (Fc)-Biotin Conjugate @PN=ADI-90440
product: Anti-(Swine/Porcine) IgG (Fc)-FITC Conjugate @PN=ADI-90430
product: Anti-(Swine/Porcine) IgG (Fc)-HRP Conjugate @PN=ADI-90420
product: Anti-(Swine/Porcine) IgG (H+L), aff pure, unconjugated @PN=ADI-90325
product: Anti-(Swine/Porcine) IgG (H+L)-Biotin conjugate @PN=ADI-90340
product: Anti-(Swine/Porcine) IgG (H+L)-FITC conjugate @PN=ADI-90330
product: Anti-(Swine/Porcine) IgG (H+L)-HRP conjugate @PN=ADI-90320
product: Anti-(Swine/Porcine) IgM aff pure, unlabeled @PN=ADI-90455
product: Anti-(Swine/Porcine) IgM-Biotin Conjugate @PN=ADI-90457
product: Anti-(Swine/Porcine) IgM-HRP Conjugate @PN=ADI-90456
product: Anti-acetylcholine Autoantibodies (SE RNA) , RNA Aptamer, unlabeled @PN=ADI-AR-312-U
product: Anti-Adenovirus type 2, hexon IgG (reacts with 1-7a, 8, 31, 40-41) @PN=ADI-ADV11-A
product: Anti-Adenovirus type 2, hexon IgG-Biotin conjugate @PN=ADI-ADV11-BTN
product: Anti-Adenovirus type 2, hexon IgG-FITC conjugate @PN=ADI-ADV11-FITC
product: Anti-Adenovirus type 2, hexon IgG-HRP conjugate @PN=ADI-ADV11-HRP
product: Anti-Alligator IgG (H+L chain) IgG unconjugated, aff pure @PN=ADI-30814-A
product: Anti-Alligator IgG (H+L chain) IgG-HRP Conjugate @PN=ADI-30814-HP
product: anti-Allograft Infl. Factor-1, Clone 1022-5 Biotin @PN=T-1067
product: anti-Allograft Infl. Factor-1:FITC, Clone 1022-5 @PN=T-1066
product: anti-Alternanthera mosaic virus /Papaya Mosaic Virus:UC (AltMV/PapMV), Polyclonal, CAB @PN=CAB53400-5000
product: anti-Alternanthera mosaic virus /Papaya Mosaic Virus:UC (AltMV/PapMV), Polyclonal, CAB @PN=CAB53400-1000
product: anti-Alternanthera mosaic virus /Papaya Mosaic Virus:UC (AltMV/PapMV), Polyclonal, CAB @PN=CAB53400-0500
product: Anti-Anthrax Spore extract antigen (90 kda), aff pure IgG #1 @PN=ADI-SA11-A
product: anti-anti MARCO, Clone ED31 @PN=T-2026
product: Anti-B. Anthracis Anthrax protective antigen 83 (PA83) (C-terminal peptide) IgG @PN=ADI-PA17-A
product: Anti-B. Anthracis Anthrax protective antigen 83 (PA83) recomb. Protein antiserum @PN=ADI-PA19-S
product: Anti-B. Anthracis Anthrax protective antigen 83 (PA83) recomb. Protein antiserum @PN=ADI-PA18-S
product: Anti-B. Anthracis Edema factor (EF) (C-terminal peptide) IgG#2 @PN=ADI-EF12-A
product: Anti-B. Anthracis Lethal factor (LF) (C-terminal peptide) IgG#3 @PN=ADI-LF13-A
product: Anti-B. Anthracis Lethal factor (LF) recombinant protein antiserum @PN=ADI-LF14-S
product: Anti-B. Anthracis Lethal factor (LF) recombinant protein antiserum @PN=ADI-LF17-S
product: Anti-B. pertussis Filamentous hemeagglutinin (FHA) protein antiserum @PN=ADI-FHA11-S
product: Anti-B. pertussis Pertactin (full length, 91 kda) protein antiserum @PN=ADI-PRN11-S
product: Anti-Bacillus calemette-Guerin (BCG) proteins (M. bovis) antiserum @PN=ADI-BCG11-S
product: Anti-Bacterial Ornithine Decarboxylase (ODC) antiserum @PN=ADI-ODC12-S
product: Anti-Bacterial Outer Membrane Protein-A (Omp-A, 19-Kda), H. pylori, IgG @PN=ADI-OMPA11-M
product: Anti-Bat IgG (H+L chain) IgG, unconjugated, aff pure @PN=ADI-30816-A
product: Anti-Bat IgG (H+L chain) IgG-HRP Conjugate @PN=ADI-30816-HP
product: Anti-Benzodiazepine IgG aff pure @PN=ADI-BNZE13-A
product: Anti-Beta Lactamase (E. coli) antiserum @PN=ADI-BLAC11-S
product: Anti-Biotin IgG, aff pure, unlabeled @PN=ADI-20361-UL
product: Anti-Biotin-AP (Alk Phosphatase) conjugate @PN=ADI-20362
product: Anti-Biotin-HRP (Peroxidase) conjugate @PN=ADI-20361
product: Anti-Bird IgG (H+L), unlabeled @PN=ADI-90519
product: Anti-Bird IgG (H+L)-Biotin conjugate @PN=ADI-90540
product: Anti-Bird IgG (H+L)-FITC conjugate @PN=ADI-90530
product: Anti-Bird IgG (H+L)-HRP conjugate @PN=ADI-90520
product: Anti-Bird IgM antibody, aff pure @PN=ADI-90521-UL
next products: next 1000 products